1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Cadherins
  5. LI-Cadherin/Cadherin-17
  6. Cadherin-17 Protein, Human (105a.a, HEK293, mFc)

Cadherin-17 Protein, Human (105a.a, HEK293, mFc)

Cat. No.: HY-P704141
Handling Instructions Technical Support

Cadherin-17 protein mediates cell-cell interactions, sorting and organizing heterogeneous cell types by preferentially binding to other Cadherin-17 molecules. LI-cadherin, a subtype of Cadherin-17, is implicated in liver and intestinal morphological organization. Cadherin-17 also facilitates intestinal peptide transport, emphasizing its functional significance. Cadherin-17 Protein, Human (105a.a, HEK293, mFc) is the recombinant human-derived Cadherin-17 protein, expressed by HEK293, with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cadherin-17 protein mediates cell-cell interactions, sorting and organizing heterogeneous cell types by preferentially binding to other Cadherin-17 molecules. LI-cadherin, a subtype of Cadherin-17, is implicated in liver and intestinal morphological organization. Cadherin-17 also facilitates intestinal peptide transport, emphasizing its functional significance. Cadherin-17 Protein, Human (105a.a, HEK293, mFc) is the recombinant human-derived Cadherin-17 protein, expressed by HEK293, with C-mFc labeled tag.

Background

Cadherin-17 protein, a calcium-dependent cell adhesion molecule, is involved in mediating cell-cell interactions. Through its preferential homophilic interaction with other cadherin molecules of the same type in connecting cells, Cadherin-17 contributes to the sorting and organization of heterogeneous cell types. Specifically, LI-cadherin, a subtype of Cadherin-17, may play a role in the morphological organization of the liver and intestine. Furthermore, Cadherin-17 is involved in facilitating intestinal peptide transport, highlighting its functional significance in cellular processes.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

Q12864 (Q13-Q128)

Gene ID

1015

Molecular Construction
N-term
Cadherin-17 (Q13-Q128)
Accession # Q12864
mFc
C-term
Protein Length

Partial

Synonyms
Cadherin-17; CDH17; Intestinal Peptide-Associated Transporter HPT-1; Liver-intestine cadherin (LI-cadherin); CDH17/Cadherin 17 Domain 1
AA Sequence

QEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDINDNRPTFLQ

Predicted Molecular Mass
38.3 kDa
Molecular Weight

Approximately 43-53 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

Greater than 95% as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Cadherin-17 Protein, Human (105a.a, HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cadherin-17 Protein, Human (105a.a, HEK293, mFc)
Cat. No.:
HY-P704141
Quantity:
MCE Japan Authorized Agent: