1. Recombinant Proteins
  2. Complement System
  3. Complement Component 1
  4. C1q
  5. Complement C1q A-Chain (C1QA)
  6. C1QA Protein, Mouse (P.pastoris, His)

The C1QA protein helps form C1, the starting component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived C1QA protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE C1QA Protein, Mouse (P.pastoris, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The C1QA protein helps form C1, the starting component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived C1QA protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

C1QA protein plays a pivotal role in the formation of C1, the initiating component of the serum complement system. C1q associates with the proenzymes C1r and C1s, resulting in the assembly of C1. The collagen-like regions of C1q engage with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 occurs upon the interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibodies within immune complexes. Active C1 constitutes a calcium-dependent trimolecular complex composed of C1q, C1r, and C1s in a molar ratio of 1:2:2. The C1q subcomponent consists of nine subunits, with six forming disulfide-linked dimers of the A and B chains, and the remaining three forming disulfide-linked dimers of the C chain. Additionally, C1QA interacts via its C-terminus with CD33, activating CD33 inhibitory motifs.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

P98086 (E23-A245)

Gene ID
Molecular Construction
N-term
6*His
C1QA (E23-A245)
Accession # P98086
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C1qaComplement C1q subcomponent subunit A
AA Sequence

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Molecular Weight

Approximately 25.6 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

C1QA Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
C1QA Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71718
Quantity:
MCE Japan Authorized Agent: