1. Recombinant Proteins
  2. Others
  3. C1orf33/MRTO4 Protein, Human (His)

C1orf33/MRTO4 is an integral component of ribosome assembly, binds to the 60S presubunit in the nucleolus, and is subsequently replaced by P0 during maturation, contributing to ribosome biogenesis. It interacts with MINAS-60, a replacement for the RBM10 open reading frame. C1orf33/MRTO4 Protein, Human (His) is the recombinant human-derived C1orf33/MRTO4 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

C1orf33/MRTO4 is an integral component of ribosome assembly, binds to the 60S presubunit in the nucleolus, and is subsequently replaced by P0 during maturation, contributing to ribosome biogenesis. It interacts with MINAS-60, a replacement for the RBM10 open reading frame. C1orf33/MRTO4 Protein, Human (His) is the recombinant human-derived C1orf33/MRTO4 protein, expressed by E. coli , with N-His labeled tag.

Background

C1orf33/MRTO4, a vital player in ribosome assembly, serves as a nuclear paralog of the ribosomal protein P0. It engages with pre-60S subunits during the initial stages of assembly within the nucleolus. Notably, in the subsequent maturation process, C1orf33/MRTO4 is displaced by P0, leading to the formation of cytoplasmic pre-60S subunits and mature 80S ribosomes. This protein actively associates with the pre-60S ribosomal particle, contributing to the intricate machinery orchestrating ribosome biogenesis. Additionally, C1orf33/MRTO4 exhibits interaction with MINAS-60, a product arising from an alternative open reading frame of RBM10, highlighting its involvement in diverse cellular processes.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9UKD2 (M1-D239)

Gene ID
Molecular Construction
N-term
His
C1orf33 (M1-D239)
Accession # Q9UKD2
C-term
Protein Length

Full Length

Synonyms
mRNA turnover protein 4 homolog; MRTO4; C1orf33; MRT4
AA Sequence

MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD

Molecular Weight

Approximately 32 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

C1orf33/MRTO4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
C1orf33/MRTO4 Protein, Human (His)
Cat. No.:
HY-P75465
Quantity:
MCE Japan Authorized Agent: