1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Butyrophilins
  4. BTNL6
  5. BTNL6 Protein, Mouse (HEK293, His)

BTNL6 Protein, part of the immunoglobulin superfamily in the BTN/MOG family, is associated with immune responses and cellular recognition. Its membership suggests involvement in diverse immunological processes, potentially contributing to intricate immune regulation. Further exploration is needed to understand BTNL6's specific functions within the broader immunoglobulin superfamily context and its role in modulating immune responses. BTNL6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTNL6 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTNL6 Protein, part of the immunoglobulin superfamily in the BTN/MOG family, is associated with immune responses and cellular recognition. Its membership suggests involvement in diverse immunological processes, potentially contributing to intricate immune regulation. Further exploration is needed to understand BTNL6's specific functions within the broader immunoglobulin superfamily context and its role in modulating immune responses. BTNL6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTNL6 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

BTNL6 protein is a member of the immunoglobulin superfamily and is classified within the BTN/MOG family. This affiliation indicates its association with molecules involved in immune responses and cellular recognition. As a member of the immunoglobulin superfamily, BTNL6 likely participates in diverse immunological processes, potentially engaging in intricate interactions that contribute to immune regulation. Further exploration is warranted to elucidate the specific functions and implications of BTNL6 within the broader context of the immunoglobulin superfamily and its role in modulating immune responses.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

A2CG22 (K29-W249)

Gene ID

624681  [NCBI]

Molecular Construction
N-term
BTNL6 (K29-W249)
Accession # A2CG22
6*His
C-term
Protein Length

Partial

Synonyms
BTNL6; Gm6519; NG13; Butyrophilin-like 6; EG624681
AA Sequence

KEFQVFGPSDPIVAAPGGEAILPCSVIPAMNVENMEELRWFRSRFSAAVLVYRDQEEQKREQLPEYSQRTSLVKEQFHQGTAAVRILNVQAPDSGIYICHFKQGVFYEEAILELKVAAMGSVPEVYIKGPEDGGVCVVCITSGWYPEPQVHWKDSRGEKLTASLEIHSEDAQGLFRTETSLVVRDSSVRNVTCSTFNPILGQEKAMAMFLPEPFFPKVSPW

Molecular Weight

Approximately 30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine, 6% Trehalose, 4% Mannitol, 50 mM NaCl, 0.05% Tween 80, pH 6.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BTNL6 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTNL6 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72762
Quantity:
MCE Japan Authorized Agent: