1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins
  4. BTLA BTLA/CD272
  5. BTLA/CD272 Protein, Rat (HEK293, mFc)

BTLA/CD272 protein inhibits antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It regulates immune responses through cis and trans interactions with TNFRSF14. In cis, it maintains resting state in naive T cells, while in trans, it supports survival signals in effector T cells. BTLA/CD272 interacts with PTPN6/SHP-1, PTPN11/SHP-2, and TNFRSF14/HVEM. BTLA/CD272 Protein, Rat (HEK293, mFc) is the recombinant rat-derived BTLA/CD272 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTLA/CD272 protein inhibits antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It regulates immune responses through cis and trans interactions with TNFRSF14. In cis, it maintains resting state in naive T cells, while in trans, it supports survival signals in effector T cells. BTLA/CD272 interacts with PTPN6/SHP-1, PTPN11/SHP-2, and TNFRSF14/HVEM. BTLA/CD272 Protein, Rat (HEK293, mFc) is the recombinant rat-derived BTLA/CD272 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

BTLA/CD272 protein serves as an inhibitory receptor on lymphocytes, exerting negative regulation on antigen receptor signaling through PTPN6/SHP-1 and PTPN11/SHP-2. It engages in both cis and trans interactions with TNFRSF14. In cis interactions, BTLA/CD272 plays an immune regulatory role, inhibiting trans interactions in naive T cells to maintain a resting state. Conversely, in trans interactions, it can predominate during adaptive immune responses, providing survival signals to effector T cells. The protein interacts with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 and also engages with TNFRSF14/HVEM through its cysteine-rich domain 1.

Biological Activity

Measured by its binding ability in a functional ELISA. When Mouse HVEM/TNFRSF14 is immobilized at 0.5 μg/mL(100 μL/well)can bind Recombinant Rat BTLA. The ED50 for this effect is approximately 1.083 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Mouse HVEM/TNFRSF14 is immobilized at 0.5 μg/mL(100 μL/well)can bind Recombinant Rat BTLA. The ED50 for this effect is approximately 1.083 μg/mL.
Species

Rat

Source

HEK293

Tag

C-mFc

Accession

Q6PNM1 (K30-Y183)

Gene ID
Molecular Construction
N-term
BTLA (K30-Y183)
Accession # Q6PNM1
mFc
C-term
Protein Length

Extracellular Domain

Synonyms
B- and T-lymphocyte attenuator; CD272; BTLA
AA Sequence

KEPTKRIGEECRVQLKIKRNSSRSAWTGELFKIECPVTYCVHRPNVTWCKHNGTRCVPLEVGPQLHTSWVENDQASAFVLYFEPIHLSDDGVYTCSANLNSEVINSHSVVIHVTERTQNCSEHPLITASDIPDATNASRPSTMEERPGRTWLLY

Molecular Weight

Approximately 55-77 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTLA/CD272 Protein, Rat (HEK293, mFc)
Cat. No.:
HY-P75466
Quantity:
MCE Japan Authorized Agent: