1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins
  4. BTLA BTLA/CD272
  5. BTLA/CD272 Protein, Human (HEK293, His)

The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (HEK293, His) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (HEK293, His) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

BTLA/CD272, an inhibitory receptor expressed on lymphocytes, serves as a negative regulator of antigen receptor signaling through interactions with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. These interactions contribute to the modulation of immune responses and the maintenance of lymphocyte homeostasis. BTLA may engage in both cis and trans interactions with TNFRSF14, with cis interactions playing a regulatory role in naive T cells, inhibiting trans interactions to maintain a resting state. In contrast, trans interactions, predominant during adaptive immune responses, provide survival signals to effector T cells. The intricate interplay between BTLA and its binding partners underscores its multifaceted role in immune regulation.

Biological Activity

Loaded Venanprubart (HY-P990773) on AHC2 biosensor, can bind BTLA/CD272 Protein, Human (HEK293, His) with an affinity constant of 1.870E-09 M as determined in BLI assay.

  • Loaded Venanprubart (HY-P990773) on AHC2 biosensor, can bind BTLA/CD272 Protein, Human (HEK293, His) with an affinity constant of 1.870E-09 M as determined in BLI assay.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q7Z6A9-2 (K31-L150)

Gene ID
Molecular Construction
N-term
BTLA (K31-L150)
Accession # Q7Z6A9-2
6*His
C-term
Synonyms
rHuBTLA/CD272, His; B- and T-Lymphocyte Attenuator; CD272; BTLA
AA Sequence

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLHHHHHH

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BTLA/CD272 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTLA/CD272 Protein, Human (HEK293, His)
Cat. No.:
HY-P7678
Quantity:
MCE Japan Authorized Agent: