BSSP-4 Protein, Human (HEK293, His)

BSSP-4 Protein is notable for its specific preference in cleaving the synthetic substrate H-D-Leu-Thr-Arg-pNA over tosyl-Gly-Pro-Arg-pNA. This enzymatic selectivity indicates BSSP-4's potential modulation of specific peptide sequences, emphasizing its relevance in biological processes. BSSP-4 Protein, Human (HEK293, His) is the recombinant human-derived BSSP-4 protein, expressed by HEK293 , with C-6*His labeled tag.

The BSSP-4 protein takes center stage as it exhibits a distinct preference for cleaving the synthetic substrate H-D-Leu-Thr-Arg-pNA in comparison to tosyl-Gly-Pro-Arg-pNA. This enzymatic specificity highlights BSSP-4's selectivity in substrate recognition and cleavage, showcasing its potential role in modulating specific peptide sequences. The preference for H-D-Leu-Thr-Arg-pNA over tosyl-Gly-Pro-Arg-pNA suggests a substrate specificity that could be relevant to the protein's functional role in biological processes.

Human

HEK293

C-6*His

Q9GZN4 (A33-S317)

64063  [NCBI]

ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARS

33-35 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.