1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-4
  6. BMP-4 Protein, Human

Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A) to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects. BMP-4 Protein, Human has a total length of 116 amino acids (S293-R408), is expressed in E. coli cells with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells[1]. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A)[2] to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects[3]. BMP-4 Protein, Human has a total length of 116 amino acids (S293-R408), is expressed in E. coli cells with tag free.

Background

Bone Morphogenetic Protein 4 (BMP-4) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-4 involves in the vasculature circulation and can activate receptors on vascular cells[1].
BMP-4/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[4].
BMP-4 is widely found in different animals, while the sequence in human is highly similar to Rat (96.81%), and mouse (97.54%).
BMP-4 is expressed by endothelial cells (ECs) in response to hypoxia and promotes vascular SMC proliferation. Therefore it inhibits the proliferation of smooth muscle cells (SMCs) isolated from the proximal pulmonary artery while induces proliferation of SMCs isolated from distal pulmonary arteries[5].
BMP-4 appears to be a marker and driver of vascular calcification, particularly in atherosclerosis[6].
BMP-4 induces angiogenesis, endothelial cells (ECs) proliferation, and migration[7].
BMP-4 is differentially expressed in calcified atherosclerotic plaques[8], serves as the linkers between atherosclerotic vascular calcification with mechanisms of normal bone formation[9].
BMP-4 increases plaque formation via their pro-inflammatory and pro-atherogenic effects, promoting oxidative stress, endothelial dysfunction and osteogenic differentiation[3].

In Vitro

BMP-4 (1 ng/mL for 4-5 d; 10 ng/mL for 3-4 d; 100 ng/mL for 2 d) induces a synchronous wave of differentiation occurred, characterized by flattened, enlarged cells with reduced proliferation[10].
BMP-4 (100 ng/mL; 7 d) initiates human embryonic stem cell differentiation to trophoblast[10].
BMP4 (10 or 100 ng/mL; 24 h) significantly increases the number of mesenchymal condensations by approximately 50%[11].

Biological Activity

Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells.The ED50 for this effect is < 60 ng/mL.

  • Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells.The ED50 for this effect is 0.9255 ng/mL, corresponding to a specific activity is 1.08×106 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P12644 (S293-R408)

Gene ID

652  [NCBI]

Molecular Construction
N-term
BMP-4 (S293-R408)
Accession # P12644
C-term
Synonyms
rHuBMP-4; BMP-2B
AA Sequence

SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Molecular Weight

Approximately 13-16 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Na2CO3, 5 mM DTT, pH 11.0 or 50 mM Tris-HCL, 200 mM NaCL, 500 mM arginine, pH 8.0 or 0.1% TFA, 30% Acetonitrile, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-4 Protein, Human
Cat. No.:
HY-P7007
Quantity:
MCE Japan Authorized Agent: