1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-3B/GDF10
  6. BMP-3B/GDF10 Protein, Human (His)

Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways. BMP-3B/GDF10 Protein, Human has a total length of 110 amino acids (Q369-R478), is expressed in E. coli cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE BMP-3B/GDF10 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity[1]. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways[2]. BMP-3B/GDF10 Protein, Human has a total length of 110 amino acids (Q369-R478), is expressed in E. coli cells.

Background

Bone Morphogenetic Protein 3 (BMP-3) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-3 is a major component of osteogenin, which has osteogenic activity[1]. BMP-3 is widely found in different animals, while the sequence in human is lowly similar to Rat (81.94%), and mouse (80.86%).
BMP-3 particularly serves as a reliable biomarker for screening colorectal cancer (CRC) because BMP-3 is hypermethylated and its protein expression is significantly reduced in cancer cell lines[2].
BMP-3 also plays a suppressor role in carcinogenesis, suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways[2].
BMP-3 could exert two-way regulatory effects on activin signaling in distinct cell types. BMP-3 stimulates proliferation of human mesenchymal stem cells which could be blocked by TGF-β/activin receptor kinase inhibitors[3].
BMP/TGFβ signaling to involve in vascular and valvular homeostasis, which is a critical process of embryonic development[4]. And BMP/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[5].

In Vitro

BMP-3 (1, 10, 50, and 10 ng/mL; 7, 14, and 21 d) alone and in combination with 10 ng/mL TGF-β promotes differentiation of human mesenchymal stem cells to a nucleus poposus phenotype[6].
BMP-3 (1, 2.5, and 10 ng/mL; 3 d) inhibits human bone marrow stromal cell (HBMSC) growth in a dose-dependent manner[7].

Species

Human

Source

E. coli

Tag

N-10*His

Accession

P55107 (Q369-R478)

Gene ID
Molecular Construction
N-term
10*His
BMP-3B (Q369-R478)
Accession # P55107
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuBMP-3B; BIP; BMP-3B; GDF-10
AA Sequence

MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

Molecular Weight

Approximately 16 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE..
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

BMP-3B/GDF10 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-3B/GDF10 Protein, Human (His)
Cat. No.:
HY-P7332
Quantity:
MCE Japan Authorized Agent: