1. Recombinant Proteins
  2. Others
  3. BMI1 Protein, Human (His)

BMI1 Protein, a component of the Polycomb group PRC1-like complex, maintains transcriptional repression in genes, including Hox genes, by monoubiquitinating histone H2A. It regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacts with various partners in the PRC1-like complex, such as RNF2, CBX2, CBX4, CBX8, PHC1, PHC2, PHC3, and UB2D3, forming complexes crucial for chromatin modification and gene expression control. BMI1 Protein, Human (E.coli,N-His) is the recombinant human-derived BMI1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMI1 Protein, a component of the Polycomb group PRC1-like complex, maintains transcriptional repression in genes, including Hox genes, by monoubiquitinating histone H2A. It regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacts with various partners in the PRC1-like complex, such as RNF2, CBX2, CBX4, CBX8, PHC1, PHC2, PHC3, and UB2D3, forming complexes crucial for chromatin modification and gene expression control. BMI1 Protein, Human (E.coli,N-His) is the recombinant human-derived BMI1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

BMI1 protein functions as a key component of a Polycomb group (PcG) multiprotein PRC1-like complex, crucial for maintaining the transcriptionally repressive state of various genes, including Hox genes, throughout development. This PcG PRC1 complex operates through chromatin remodeling and histone modification, specifically mediating monoubiquitination of histone H2A at 'Lys-119' to impart heritable changes in chromatin expressibility. Within the PRC1-like complex, BMI1 regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacting with various partners such as RING1, CBX7, CBX8, and PHC2, BMI1 is a critical player in nucleosomal binding and modification of histone H2A. Additionally, BMI1 forms part of a larger complex containing CUL3 and SPOP and interacts with E4F1 and zinc finger protein ZNF277, suggesting its involvement in intricate protein networks that contribute to chromatin dynamics and gene regulation during development.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P35226 (M1-G326)

Gene ID

648

Molecular Construction
N-term
6*His
BMI1 (M1-G326)
Accession # P35226
C-term
Protein Length

Full Length

Synonyms
ELAV1; Hua; HUR; MelG
AA Sequence

MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

Molecular Weight

Approximately 43 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BMI1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMI1 Protein, Human (His)
Cat. No.:
HY-P701224
Quantity:
MCE Japan Authorized Agent: