1. Recombinant Proteins
  2. Others
  3. Blot21 Protein, Blomia tropicalis (His)

Blot21 Protein, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 Protein, Blomia tropicalis (His) is the recombinant Blot21 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Blot21 Protein, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 Protein, Blomia tropicalis (His) is the recombinant Blot21 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Blot21, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 consists of three anti-parallel α-helices assembled in a helical bundle resembling that of Blot5 and Derp5[1][2].

Species

Others

Source

E. coli

Tag

N-6*His

Accession

AAX34047.1 (L17-E129)

Gene ID

/

Molecular Construction
N-term
6*His
Blot21 (L17-E129)
Accession # AAX34047.1
C-term
Synonyms
Mite allergen Blo t 21; Mite group 21 allergen Blo t 21; Blo t 21
AA Sequence

LPVSNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE

Molecular Weight

Approximately 13.5 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Blot21 Protein, Blomia tropicalis (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Blot21 Protein, Blomia tropicalis (His)
Cat. No.:
HY-P77306
Quantity:
MCE Japan Authorized Agent: