1. Recombinant Proteins
  2. Others
  3. BLOC1S2 Protein, Human (N-GST)

BLOC1S2 is an essential component of the BLOC-1 complex and is critical for the biogenesis of lysosome-related organelles (LROs), including platelet dense granules and melanosomes. BLOC-1 cooperates with the AP-3 complex to direct membrane protein cargo into vesicles for delivery to neurites and nerve terminals, suggesting that it is involved in neurite extension. BLOC1S2 Protein, Human (N-GST) is the recombinant human-derived BLOC1S2 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BLOC1S2 is an essential component of the BLOC-1 complex and is critical for the biogenesis of lysosome-related organelles (LROs), including platelet dense granules and melanosomes. BLOC-1 cooperates with the AP-3 complex to direct membrane protein cargo into vesicles for delivery to neurites and nerve terminals, suggesting that it is involved in neurite extension. BLOC1S2 Protein, Human (N-GST) is the recombinant human-derived BLOC1S2 protein, expressed by E. coli , with N-GST labeled tag.

Background

BLOC1S2 protein is a vital component of the BLOC-1 complex, crucial for the normal biogenesis of lysosome-related organelles (LRO), including platelet dense granules and melanosomes. Together with the AP-3 complex, the BLOC-1 complex is essential for directing membrane protein cargos into vesicles formed at cell bodies, facilitating their delivery into neurites and nerve terminals. The BLOC-1 complex, in conjunction with SNARE proteins, is also implicated in neurite extension. As a part of the BORC complex, BLOC1S2 may contribute to the movement and localization of lysosomes at the cell periphery, associating with the cytosolic face of lysosomes and potentially recruiting ARL8B to couple lysosomes to microtubule plus-end-directed kinesin motors. Additionally, BLOC1S2 may play a role in cell proliferation as part of the biogenesis of lysosome-related organelles complex 1 (BLOC-1) and the BLOC-one-related complex (BORC), interacting with various components within these complexes, including BLOC1S1, BLOC1S3, BLOC1S4, BLOC1S5, SNAPIN, and IFT57.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q6QNY1-2 (M1-R99)

Gene ID

282991

Molecular Construction
N-term
GST
BLOC1S2 (M1-R99)
Accession # Q6QNY1-2
C-term
Protein Length

Full Length of Isoform-2

Synonyms
Biogenesis of lysosome-related organelles complex 1 subunit 2; BLOC-1 subunit 2; BLOS2; CEAP
AA Sequence

MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR

Molecular Weight

Approximately 34 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 10% trehalose, 0.02% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BLOC1S2 Protein, Human (N-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BLOC1S2 Protein, Human (N-GST)
Cat. No.:
HY-P76171A
Quantity:
MCE Japan Authorized Agent: