1. Recombinant Proteins
  2. Others
  3. BGLAP Protein, Rat (GST)

BGLAP protein in its carboxylated form negatively regulates bone formation while promoting bone resorption and mineralization.The carboxylated form has a strong affinity for apatite and calcium.BGLAP Protein, Rat (GST) is the recombinant rat-derived BGLAP protein, expressed by E.coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BGLAP protein in its carboxylated form negatively regulates bone formation while promoting bone resorption and mineralization.The carboxylated form has a strong affinity for apatite and calcium.BGLAP Protein, Rat (GST) is the recombinant rat-derived BGLAP protein, expressed by E.coli , with N-GST labeled tag.

Background

BGLAP protein, in its carboxylated form, plays a crucial role in the bone matrix by acting as a negative regulator of bone formation while maintaining bone resorption and mineralization. This form exhibits strong binding affinity to apatite and calcium. On the other hand, the uncarboxylated form functions as a hormone secreted by osteoblasts and regulates various cellular processes including energy metabolism, male fertility, and brain development. In terms of energy metabolism, it promotes pancreatic beta-cell proliferation, insulin secretion, insulin sensitivity, and energy expenditure. Additionally, the uncarboxylated osteocalcin hormone stimulates testosterone production in the testes by acting as a ligand for G protein-coupled receptor GPRC6A on Leydig cells, resulting in the activation of CREB-dependent pathways required for testosterone synthesis. Furthermore, this hormone serves as a regulator of brain development by crossing the blood-brain barrier and binding to GPR158 on neurons. This interaction prevents neuronal apoptosis in the hippocampus, promotes the synthesis of monoamine neurotransmitters, and inhibits the synthesis of gamma-aminobutyric acid (GABA). Notably, osteocalcin also crosses the placenta during pregnancy, and maternal osteocalcin is necessary for fetal brain development.

Species

Rat

Source

E. coli

Tag

N-GST

Accession

P04640 (Y50-V99)

Gene ID
Molecular Construction
N-term
GST
BGLAP (Y50-V99)
Accession # P04640
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Bglap; Bglap2; Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein
AA Sequence

YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV

Molecular Weight

Approximately 32.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BGLAP Protein, Rat (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BGLAP Protein, Rat (GST)
Cat. No.:
HY-P72104
Quantity:
MCE Japan Authorized Agent: