1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. Nerve Growth Factor-β (Beta-NGF)
  6. pro-Beta-NGF Protein, Human (223a.a)

Pro-Beta-NGF protein plays a crucial role in the development and maintenance of the nervous system by binding to NTRK1 and NGFR receptors. Immature NGF precursors act as ligands for the SORCS2-NGFR complex, triggering signaling pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. pro-Beta-NGF Protein, Human (223a.a) is the recombinant human-derived pro-Beta-NGF protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Pro-Beta-NGF protein plays a crucial role in the development and maintenance of the nervous system by binding to NTRK1 and NGFR receptors. Immature NGF precursors act as ligands for the SORCS2-NGFR complex, triggering signaling pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. pro-Beta-NGF Protein, Human (223a.a) is the recombinant human-derived pro-Beta-NGF protein, expressed by E. coli , with tag free.

Background

The pro-Beta-NGF protein plays a crucial role in the development and maintenance of the sympathetic and sensory nervous systems. As an extracellular ligand, it engages with the NTRK1 and NGFR receptors, initiating signaling cascades that regulate neuronal proliferation, differentiation, and survival. Notably, the immature NGF precursor (proNGF) functions as a ligand for the SORCS2-NGFR heterodimeric receptor complex, activating signaling pathways that result in the inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton, and neuronal growth cone collapse. In contrast to mature NGF, proNGF promotes neuronal apoptosis in vitro. Furthermore, pro-Beta-NGF exhibits inhibitory effects on metalloproteinase-dependent proteolysis of platelet glycoprotein VI. The protein's interaction with lysophosphatidylinositol and lysophosphatidylserine, both lipid-bound and lipid-free, contributes to mast cell histamine release. The homodimeric structure of pro-Beta-NGF interacts with NTRK1, NGFR, and SORCS2, mediating various downstream effects on cellular processes. Additionally, pro-Beta-NGF binds to a receptor complex formed by SORT1 and NGFR, leading to NGF endocytosis. These intricate interactions highlight the multifaceted roles of pro-Beta-NGF in orchestrating neuronal functions and cellular responses.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01138 (E19-A241)

Gene ID
Molecular Construction
N-term
pro-Beta-NGF (E19-A241)
Accession # P01138
C-term
Synonyms
Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB
AA Sequence

EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Molecular Weight

Approximately 30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 250 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

pro-Beta-NGF Protein, Human (223a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
pro-Beta-NGF Protein, Human (223a.a)
Cat. No.:
HY-P72488
Quantity:
MCE Japan Authorized Agent: