1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. Brain Derived Neurotrophic Factor (BDNF)
  6. BDNF Protein, Mouse (R129A, R130A, HEK293, C-His)

BDNF Protein, Mouse (R129A, R130A, HEK293, C-His)

Cat. No.: HY-P74383A
Handling Instructions Technical Support

BDNF protein is an important signaling molecule that activates NTRK2 downstream cascades and affects multiple roles in neuronal development and function. It promotes survival and differentiation of the peripheral and central nervous system, affecting axonal and dendritic growth. BDNF Protein, Mouse (R129A, R130A, HEK293, C-His) is the recombinant mouse-derived BDNF protein, expressed by HEK293 , with C-6*His labeled tag and R129A, R130A mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BDNF protein is an important signaling molecule that activates NTRK2 downstream cascades and affects multiple roles in neuronal development and function. It promotes survival and differentiation of the peripheral and central nervous system, affecting axonal and dendritic growth. BDNF Protein, Mouse (R129A, R130A, HEK293, C-His) is the recombinant mouse-derived BDNF protein, expressed by HEK293 , with C-6*His labeled tag and R129A, R130A mutation.

Background

The BDNF protein serves as a pivotal signaling molecule, activating cascades downstream of NTRK2 and playing diverse roles in neuronal development and function. During development, BDNF promotes the survival and differentiation of specific neuronal populations in both the peripheral and central nervous systems, influencing axonal growth, pathfinding, and the modulation of dendritic growth and morphology. It emerges as a major regulator of synaptic transmission and plasticity in various regions of the CNS, contributing to adaptive neuronal responses such as long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, and the homeostatic regulation of intrinsic neuronal excitability. This versatility underscores its integral role in shaping neuronal connectivity and function. Additionally, BDNF activates signaling cascades through the heterodimeric receptor formed by NGFR and SORCS2, further influencing synaptic plasticity and long-term depression. Notably, its interaction with NGFR and SORCS2 is implicated in promoting neuronal apoptosis and growth cone collapse, highlighting its multifaceted impact on neuronal physiology and development.

Biological Activity

Immobilized Recombinant Human BDNF at 1 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human TrkB. The ED50 for this effect is ≤91.22 ng/mL.

  • Immobilized Recombinant Mouse BDNF at 1 μg/ml (100 μL/well) can bind Biotinylated Recombinant Mouse TrkB. The ED50 for this effect is 91.22 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P21237-1 (A19-R249, R129A, R130A)

Gene ID

12064

Molecular Construction
N-term
BDNF (A19-R249, R129A, R130A)
Accession # P21237
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Brain-derived neurotrophic factor; BDNF; ProBDNF
AA Sequence

APMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAAHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Molecular Weight

Approximately 33-42 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BDNF Protein, Mouse (R129A, R130A, HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BDNF Protein, Mouse (R129A, R130A, HEK293, C-His)
Cat. No.:
HY-P74383A
Quantity:
MCE Japan Authorized Agent: