1. Recombinant Proteins
  2. Others
  3. BD-3 Protein, Mouse

BD-3 Protein, Mouse is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BD-3 Protein, Mouse is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity.

Background

Recombinant Mouse Beta Defensin-3 peptide, produced from a baculovirus expression system, shows antimicrobial activity against P. aeruginosa PAO1 (MIC of 8 μg/mL) and Escherichia coli D31 (MIC of 16 μg/mL) in a salt-dependent manner[1]. Mouse Beta Defensin-3 peptide exhibits broad-spectrum antimicrobial activity, this peptide may serve as an innate defense against microbial invasion at specific mucosal surfaces in the mouse[2].

Biological Activity

Measured by its anti-microbial activity against E. coli. The ED50 this effect is 387.3 ng/mL, corresponding to a specific activity is 2.58×10^3 U/mg.

  • Measured by its anti-microbial activity against E. coli. The ED50 for this effect is 387.3 ng/mL, corresponding to a specific activity is 2.58×103 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q9WTL0 (K23-K63)

Gene ID
Molecular Construction
N-term
BD-3 (K23-K63)
Accession # Q9WTL0
C-term
Synonyms
rMuBD-3; DEFB-3; HBD3; Beta-defensin 103
AA Sequence

KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Molecular Weight

Approximately 10.06 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 40 mM PB, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

BD-3 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BD-3 Protein, Mouse
Cat. No.:
HY-P7138
Quantity:
MCE Japan Authorized Agent: