1. Recombinant Proteins
  2. Others
  3. BD-3 Protein, Human

BD-3 Protein, Human is an antibacterial peptide that exhibits antibacterial activities towards Gram-negative and Gram-positive bacteria as well as an ability to act as a chemo-attractant.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BD-3 Protein, Human is an antibacterial peptide that exhibits antibacterial activities towards Gram-negative and Gram-positive bacteria as well as an ability to act as a chemo-attractant.

Background

Human β-defensin-3 (HβD-3) is the most recently discovered member of the host defense peptide family. HβD-3 has been shown to exhibit antibacterial activities towards Gram-negative and Gram-positive bacteria as well as an ability to act as a chemo-attractant. HβD-3 is of special interest for structural and functional studies and also for possible pharmaceutical applications. It is also one among the identified human defensins that has the ability to undergo oligomerization[1].

Biological Activity

The ED50 is <30 μg/mL as measured by anti-microbial activity against E.coli, corresponding to a specific activity of >33.3 units/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P81534 (G23-K67)

Gene ID

55894  [NCBI]

Molecular Construction
N-term
BD-3 (G23-K67)
Accession # P81534
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuBD-3; DEFB-3; HBD3; Beta-defensin 103
AA Sequence

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Molecular Weight

Approximately 5.2 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PBS, pH 7.4, 130 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

BD-3 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BD-3 Protein, Human
Cat. No.:
HY-P7137
Quantity:
MCE Japan Authorized Agent: