1. Recombinant Proteins
  2. Others
  3. BCL2A1 Protein, Human (His)

The BCL2A1 protein plays a critical role in resisting apoptosis triggered by IL-3 deprivation, suggesting its importance in the response of hematopoietic cells to external signals and may be involved in protecting endothelial cell survival during infection. It also inhibits serum starvation-induced apoptosis in mammary epithelial cells (HC11). BCL2A1 Protein, Human (His) is the recombinant human-derived BCL2A1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BCL2A1 protein plays a critical role in resisting apoptosis triggered by IL-3 deprivation, suggesting its importance in the response of hematopoietic cells to external signals and may be involved in protecting endothelial cell survival during infection. It also inhibits serum starvation-induced apoptosis in mammary epithelial cells (HC11). BCL2A1 Protein, Human (His) is the recombinant human-derived BCL2A1 protein, expressed by E. coli , with N-His labeled tag.

Background

The BCL2A1 protein plays a crucial role in retarding apoptosis induced by IL-3 deprivation, suggesting its involvement in the response of hemopoietic cells to external signals and its potential role in maintaining endothelial survival during infection. Additionally, BCL2A1 exhibits the ability to inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11. The protein interacts directly with various key players in the apoptotic pathway, including BAK1, BID, BMF, BBC3, BCL2L11/BIM, BAX isoform Sigma, PMAIP1, RTL10/BOP, ING4, and UBQLN4. This extensive interaction network underscores the multifaceted role of BCL2A1 in modulating apoptotic processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q16548 (M1-S152)

Gene ID

597  [NCBI]

Molecular Construction
N-term
His
BCL2A1 (M1-S152)
Accession # Q16548
C-term
Protein Length

Partial

Synonyms
Bcl-2-related protein A1; Protein BFL-1; BCL2L5; BFL1; GRS; HBPA1
AA Sequence

MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKS

Molecular Weight

Approximately 16-17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BCL2A1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BCL2A1 Protein, Human (His)
Cat. No.:
HY-P75590
Quantity:
MCE Japan Authorized Agent: