1. Recombinant Proteins
  2. Others
  3. Bcl-2-like protein 2 Protein, Human (His)

Bcl-2-like protein 2 is a key regulator that promotes cell survival and prevents dexamethasone-induced apoptosis, which is critical for postmitotic Sertoli cells. It inhibits BAX, emphasizing its role in survival mechanisms. Bcl-2-like protein 2 Protein, Human (His) is the recombinant human-derived Bcl-2-like protein 2 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Bcl-2-like protein 2 is a key regulator that promotes cell survival and prevents dexamethasone-induced apoptosis, which is critical for postmitotic Sertoli cells. It inhibits BAX, emphasizing its role in survival mechanisms. Bcl-2-like protein 2 Protein, Human (His) is the recombinant human-derived Bcl-2-like protein 2 protein, expressed by E. coli , with C-6*His labeled tag.

Background

Bcl-2-like protein 2, a crucial player in cellular dynamics, exerts its influence by promoting cell survival and effectively blocking dexamethasone-induced apoptosis. This multifunctional protein plays a pivotal role in the survival of postmitotic Sertoli cells, where it suppresses the death-promoting activity of BAX. The intricate molecular network extends to interactions with HIF3A through its C-terminus domain, emphasizing its involvement in complex signaling pathways. Additionally, Bcl-2-like protein 2 engages in interactions with BOP, further highlighting its role in cellular homeostasis. The nuanced functions of Bcl-2-like protein 2 underscore its significance in orchestrating cell survival mechanisms and warrant further exploration to comprehensively understand its molecular contributions in diverse cellular contexts.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized BID at 5 μg/mL (100 μL/well) can bind human Bcl-2-like protein 2. The ED50 for this effect is 10.09 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized BID at 5 μg/mL (100 μL/well) can bind human Bcl-2-like protein 2. The ED50 for this effect is 10.09 ng/mL.
Species

Human

Source

E. coli

Tag

C-6*His

Accession

AAI13523.1 (A2-T172)

Gene ID

599  [NCBI]

Molecular Construction
N-term
BCL2L2 (A2-T172)
Accession # Q92843
6*His
C-term
Protein Length

Partial

Synonyms
rHuBcl-2-like protein 2, His; Bcl-2-Like Protein 2; Apoptosis Regulator Bcl-W; BCL2L2; KIAA0271
AA Sequence

ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRT

Molecular Weight

Approximately 18.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 25 mM HEPES, 100 mM KCl, 20% Glycerol, pH 7.5 or 20 mM HEPES, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Bcl-2-like protein 2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Bcl-2-like protein 2 Protein, Human (His)
Cat. No.:
HY-P7653
Quantity:
MCE Japan Authorized Agent: