1. Recombinant Proteins
  2. CD Antigens
  3. B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins
  4. CD147
  5. Basigin/CD147 Protein, Cynomolgus (HEK293, His)

Basigin/CD147 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P76202
Handling Instructions Technical Support

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen 尾-chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities . Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen 尾-chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Background

Basigin has isoforms; the common form (basigin or basigin-2) has two immunoglobulin domains, and the extended form (basigin-1) has three. Basigin-1 serves as the receptor for the rod-derived cone viability factor. In the same membrane plane, basigin also associates with other proteins including GLUT1, CD44 and CD98. The carbohydrate portion of basigin is recognized by lectins, such as galectin-3 and E-selectin. These molecular recognitions form the basis for the role of basigin in the transport of nutrients, migration of inflammatory leukocytes and induction of matrix metalloproteinases. Basigin is important in vision, spermatogenesis and other physiological phenomena, and plays significant roles in the pathogenesis of numerous diseases, including cancer. Basigin is also the receptor for an invasive protein RH5, which is present in malaria parasites[1].
The CD147 gene, designated BSG for basigin, is located on chromosome 19p13.3 and encodes a 29 kD protein, though migration on SDS-PAGE usually occurs between 35–65 kD, depending on the degree of glycosylation. Three glycosylation sites have been identified within the CD147 Ig like domains: two within the membrane proximal Ig domain and one within the distal Ig domain[3].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant SARS-COV-2 S Protein is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Cynomolgus CD147. The ED50 for this effect is 10.35 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant SARS-COV-2 S Protein is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Cynomolgus CD147. The ED50 for this effect is 10.35 μg/mL.
Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

XP_005587354 (A19-H209)

Gene ID
Molecular Construction
N-term
Basigin (A19-H209)
Accession # XP_005587354
6*His
C-term
Protein Length

Partial

Synonyms
Basigin; HT7 antigen; Membrane glycoprotein gp42; Bsg
AA Sequence

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Basigin/CD147 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76202
Quantity:
MCE Japan Authorized Agent: