BAMBI/NMA Protein, Human (HEK293, His)

BAMBI/NMA protein operates as a negative regulator, exerting inhibitory control over the TGF-beta signaling pathway. It finely tunes the signaling cascade initiated by TGF-beta, impacting cellular responses like proliferation, differentiation, and immune modulation. This regulatory role emphasizes BAMBI/NMA's significance in modulating diverse cellular behaviors, with potential implications in various physiological and pathological contexts. BAMBI/NMA Protein, Human (HEK293, His) is the recombinant human-derived BAMBI/NMA protein, expressed by HEK293 , with C-His labeled tag.

BAMBI/NMA protein serves as a negative regulator of TGF-beta signaling, exerting inhibitory control over this crucial cellular pathway. Its role involves tempering the signaling cascade initiated by TGF-beta, thereby influencing various cellular responses. By negatively regulating TGF-beta signaling, BAMBI/NMA contributes to the fine-tuned balance of this pathway, impacting processes such as cell proliferation, differentiation, and immune modulation. This regulatory function underscores the protein's significance in modulating cellular behaviors and highlights its potential implications in various physiological and pathological contexts.

Human

HEK293

C-6*His

Q13145 (V21-A152)

25805  [NCBI]

VLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRA

Approximately 16-23 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.