1. Recombinant Proteins
  2. Others
  3. BamA Protein, E.coli (Myc, His)

BamA is a key member of the outer membrane protein assembly complex (Bam), which concentrates the assembly of β-barrel proteins into the outer membrane. Together with BamD, BamA forms the core mechanism of this process, which relies on the coordinated action of all five subunits. BamA Protein, E.coli (Myc, His) is the recombinant E. coli-derived BamA protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BamA is a key member of the outer membrane protein assembly complex (Bam), which concentrates the assembly of β-barrel proteins into the outer membrane. Together with BamD, BamA forms the core mechanism of this process, which relies on the coordinated action of all five subunits. BamA Protein, E.coli (Myc, His) is the recombinant E. coli-derived BamA protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Background

BamA, a pivotal component of the outer membrane protein assembly complex (Bam), plays a central role in the intricate process of assembling and inserting beta-barrel proteins into the outer membrane. Together with BamD, BamA constitutes the core machinery of this assembly process, and the efficient folding and insertion of substrates into the outer membrane require the coordinated action of all five subunits. BamA's structural features include a beta-barrel with a lateral gate that opens between the first and last strands, facilitating the insertion of substrates into the outer membrane. Acting as a receptor for CdiA-EC93, the contact-dependent growth inhibition effector of E.coli strain EC93, BamA is crucial in mediating this microbial interaction. Notably, its susceptibility to CdiA-EC93 is dependent on the specific BamA variant present, as replacing BamA with homologs from different bacterial strains alters susceptibility. Additionally, BamA's role in CDI appears independent of other components of the Bam complex.

Species

E.coli

Source

E. coli

Tag

N-10*His;C-Myc

Accession

P0A940 (A175-G424)

Gene ID

944870  [NCBI]

Molecular Construction
N-term
10*His
BamA (A175-G424)
Accession # P0A940
Myc
C-term
Protein Length

Partial

Synonyms
bamA; yaeT; yzzN; yzzY; b0177; JW0172Outer membrane protein assembly factor BamA; Omp85
AA Sequence

AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG

Molecular Weight

Approximately 36.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4 .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BamA Protein, E.coli (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BamA Protein, E.coli (Myc, His)
Cat. No.:
HY-P71515
Quantity:
MCE Japan Authorized Agent: