1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily B Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands CD257/BAFF
  5. B-cell Activating Factor (BAFF)
  6. BAFF/TNFSF13B Protein, Rhesus Macaque (HEK293, Fc)

BAFF/TNFSF13B Protein, Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P72442
Handling Instructions Technical Support

The BAFF/TNFSF13B protein is a member of the tetraspanin (TM4SF) family and is actively involved in a variety of cellular processes. BAFF/TNFSF13B is a component of the tetraspanin superfamily and is critical for cell adhesion, migration, and signaling events. BAFF/TNFSF13B Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived BAFF/TNFSF13B protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BAFF/TNFSF13B protein is a member of the tetraspanin (TM4SF) family and is actively involved in a variety of cellular processes. BAFF/TNFSF13B is a component of the tetraspanin superfamily and is critical for cell adhesion, migration, and signaling events. BAFF/TNFSF13B Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived BAFF/TNFSF13B protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CD53, a member of the tetraspanin (TM4SF) family, is a transmembrane protein involved in various cellular processes. As a part of the larger tetraspanin superfamily, CD53 plays a crucial role in mediating cell adhesion, migration, and signaling events. This family is characterized by proteins with four transmembrane domains, contributing to the formation of multimolecular complexes on the cell surface known as tetraspanin-enriched microdomains (TEMs). CD53, like other tetraspanins, is known to interact with partner proteins, including integrins and other tetraspanins, influencing cellular functions such as immune responses, cell adhesion, and signal transduction. The diverse functions of CD53 underscore the importance of tetraspanins in modulating cellular behavior and their potential as therapeutic targets in various physiological and pathological contexts.

Species

Rhesus Macaque

Source

HEK293

Tag

N-hFc

Accession

F7HHH0 (A134-L285)

Gene ID
Molecular Construction
N-term
hFc
BAFF (A134-L285)
Accession # F7HHH0
C-term
Protein Length

Partial

Synonyms
TNF superfamily member 13b; TNFSF13B; TNLG7A
AA Sequence

AIQGAEETVIQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

Predicted Molecular Mass
42.9 kDa
Molecular Weight

Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BAFF/TNFSF13B Protein, Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P72442
Quantity:
MCE Japan Authorized Agent: