1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. ATP6V1F Protein, Human

ATP6V1F is an important subunit of the vacuolar (H+)-ATPase (V-ATPase) V1 complex and is an important component of this enzyme's role in cellular pH regulation. It forms a catalytic AB heterodimer and peripheral stem that plays a role in ATP hydrolysis. ATP6V1F Protein, Human is the recombinant human-derived ATP6V1F protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ATP6V1F is an important subunit of the vacuolar (H+)-ATPase (V-ATPase) V1 complex and is an important component of this enzyme's role in cellular pH regulation. It forms a catalytic AB heterodimer and peripheral stem that plays a role in ATP hydrolysis. ATP6V1F Protein, Human is the recombinant human-derived ATP6V1F protein, expressed by E. coli , with tag free.

Background

ATP6V1F, a vital subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), constitutes part of the multisubunit enzyme that plays a central role in cellular pH regulation. This enzyme is a heteromultimeric assembly comprising two essential complexes: the ATP-hydrolytic V1 complex and the proton translocation V0 complex. Within the V1 complex, ATP6V1F contributes to the formation of the catalytic AB heterodimers, constituting a heterohexamer, and the peripheral stalks comprised of EG heterodimers. Additionally, it is an integral part of the central rotor, working in concert with subunit D. The V1 complex is responsible for ATP hydrolysis, whereas the V0 complex, in which ATP6V1F is not directly mentioned but is implied, is crucial for proton translocation across membranes. This proton transport involves various subunits, including the proton transport subunit a, a ring of proteolipid subunits c9c'', rotary subunit d, subunits e and f, and accessory subunits ATP6AP1/Ac45 and ATP6AP2/PRR. The cooperative action of these subunits underscores the significance of ATP6V1F in the intricate machinery of V-ATPase, which acidifies and maintains pH in cellular compartments and, in certain cell types, at the plasma membrane, thereby influencing various physiological processes.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human ATP6V1F is present at 2 μg/mL, can bind ATP6V1F antibody. The ED50 for this effect is 195 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human ATP6V1F is present at 2 μg/mL, can bind ATP6V1F antibody.The ED50 for this effect is 195 ng/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q16864 ( M1-R119 )

Gene ID

9296

Molecular Construction
N-term
ATP6V1F ( M1-R119 )
Accession # Q16864
C-term
Protein Length

Full Length

Synonyms
V-type proton ATPase subunit F
AA Sequence

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR

Molecular Weight

Approximately 13 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ATP6V1F Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ATP6V1F Protein, Human
Cat. No.:
HY-P76159A
Quantity:
MCE Japan Authorized Agent: