1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Translocases (EC 7)
  4. ATP5MG Protein, Bovine (Myc, His)

ATP5MG Protein, an essential part of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. Positioned within the F(0) domain as a minor subunit alongside subunit a, ATP5MG collaborates with various subunits in the overall F-type ATPase complex, including CF(1) and CF(0), to ensure efficient ATP synthesis. ATP5MG Protein, Bovine (Myc, His) is the recombinant bovine-derived ATP5MG protein, expressed by E. coli , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ATP5MG Protein, an essential part of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. Positioned within the F(0) domain as a minor subunit alongside subunit a, ATP5MG collaborates with various subunits in the overall F-type ATPase complex, including CF(1) and CF(0), to ensure efficient ATP synthesis. ATP5MG Protein, Bovine (Myc, His) is the recombinant bovine-derived ATP5MG protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Background

The ATP5MG protein is an integral component of the mitochondrial membrane ATP synthase, also known as Complex V, responsible for generating ATP from ADP in the presence of a proton gradient produced by the respiratory chain's electron transport complexes. F-type ATPases comprise two primary structural domains: F(1), housing the extramembraneous catalytic core, and F(0), encompassing the membrane proton channel. These domains are interconnected by a central stalk and a peripheral stalk. During the catalytic process, ATP synthesis in the F(1) domain is coordinated with proton translocation through a rotary mechanism involving the central stalk subunits. ATP5MG specifically resides within the F(0) domain, acting as a minor subunit alongside subunit a in the membrane. The overall F-type ATPase complex consists of CF(1), the catalytic core, and CF(0), the membrane proton channel, with CF(0) comprising nine subunits: a, b, c, d, e, f, g, F6, and 8 (or A6L). ATP5MG is a crucial component of the ATP synthase complex, working in collaboration with various subunits to facilitate ATP synthesis.

Species

Bovine

Source

E. coli

Tag

N-His;C-Myc

Accession

Q28852 (A2-V103)

Gene ID
Molecular Construction
N-term
10*His
ATP5MG (A2-V103)
Accession # Q28852
Myc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
ATP5MG; ATP5LATP synthase subunit g; mitochondrial; ATPase subunit g; ATP synthase membrane subunit g
AA Sequence

AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV

Molecular Weight

Approximately 18.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ATP5MG Protein, Bovine (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ATP5MG Protein, Bovine (Myc, His)
Cat. No.:
HY-P71550
Quantity:
MCE Japan Authorized Agent: