1. Recombinant Proteins
  2. Others
  3. ARL2BP Protein, Human (GST)

The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (GST) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (GST) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-GST labeled tag.

Background

The ARL2BP protein, in collaboration with ARL2, assumes a pivotal role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its involvement in cellular processes. Acting potentially as an effector of ARL2, ARL2BP is found in complexes with ARL2 and SLC25A6, as well as ARL2, ARL2BP, and SLC25A4. It interacts with key transcription factors, including STAT2, STAT3, and STAT4, with an enhanced interaction with STAT3 in the presence of ARL2. Notably, ARL2BP's association with GTP-bound ARL2 and ARL3, either as the ARL2-ARL2BP complex or ARL2BP alone, binds to SLC25A4, suggesting a role in protein targeting. Additionally, the interaction with ARL2 may be crucial for the specific targeting of ARL2BP to the cilia basal body. These intricate associations underscore ARL2BP's multifaceted involvement in cellular signaling and localization processes.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9Y2Y0-1 (M1-H163)

Gene ID
Molecular Construction
N-term
GST
ARL2BP (M1-H163)
Accession # Q9Y2Y0-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
ADP ribosylation factor like 2 binding protein; ADP-ribosylation factor-like protein 2-binding protein; ARL2BP protein; BART; BART1; Binder of ARF2 protein 1
AA Sequence

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Predicted Molecular Mass
45.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ARL2BP Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ARL2BP Protein, Human (GST)
Cat. No.:
HY-P71660
Quantity:
MCE Japan Authorized Agent: