1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Arginase-1/ARG1 Protein, Human (N-His)

Arginase-1 (ARG1) protein, crucial in the urea cycle, converts L-arginine to urea and L-ornithine. ARG1 also regulates L-arginine levels outside the liver, impacting immune responses. ARG1's release by granulocytes suppresses T cell and NK cell functions. In ILC2s, ARG1 promotes lung inflammation. However, ARG1's role in human monocytic/macrophage/dendritic cells is unclear. Arginase-1/ARG1 Protein, Human (N-His) is the recombinant human-derived Arginase-1/ARG1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Arginase-1 (ARG1) protein, crucial in the urea cycle, converts L-arginine to urea and L-ornithine. ARG1 also regulates L-arginine levels outside the liver, impacting immune responses. ARG1's release by granulocytes suppresses T cell and NK cell functions. In ILC2s, ARG1 promotes lung inflammation. However, ARG1's role in human monocytic/macrophage/dendritic cells is unclear. Arginase-1/ARG1 Protein, Human (N-His) is the recombinant human-derived Arginase-1/ARG1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Arginase-1 (ARG1) protein is a crucial component of the urea cycle, facilitating the conversion of L-arginine to urea and L-ornithine. This cycle primarily occurs in the liver and, to a lesser extent, in the kidneys. Beyond its role in nitrogen metabolism, ARG1 plays a pivotal role in L-arginine homeostasis in nonhepatic tissues, where it competes with nitric oxide synthase (NOS) for intracellular arginine, impacting innate and adaptive immune responses. The antimicrobial effector pathway in polymorphonuclear granulocytes involves ARG1, released upon cell death, which depletes arginine in the microenvironment, leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion. In group 2 innate lymphoid cells (ILC2s), ARG1 promotes acute type 2 inflammation in the lung, influencing ILC2 proliferation. However, the precise immunological role of ARG1 in the monocytic/macrophage/dendritic cell lineage in humans remains uncertain.

Biological Activity

Measured by its binding ability in the production of urea during the hydrolysis of arginine. The specific activity is 129570.707 pmol/min/µg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P05089 (M1-K322)

Gene ID

383  [NCBI]

Molecular Construction
N-term
6*His
ARGI1 (M1-K322)
Accession # P05089
C-term
Protein Length

Full Length

Synonyms
rHuArginase-1, His; ARG1; Arginase-1
AA Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Molecular Weight

Approximately 40 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Arginase-1/ARG1 Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Arginase-1/ARG1 Protein, Human (N-His)
Cat. No.:
HY-P7541A
Quantity:
MCE Japan Authorized Agent: