ARF1 Protein, Human (His-GST, Myc)

ARF1 is a small GTPase responsible for coordinating protein transport within the Golgi complex. In its GTP-bound state, ARF1 critically regulates Golgi vesicle budding and uncoating by recruiting coat proteins. ARF1 Protein, Human (His-GST, Myc) is the recombinant human-derived ARF1 protein, expressed by E. coli , with N-10*His, C-Myc, GST labeled tag.

ARF1, a small GTPase, intricately participates in protein trafficking among distinct cellular compartments, notably within the Golgi complex. In its GTP-bound state, ARF1 plays a pivotal role in modulating vesicle budding and uncoating processes within the Golgi, orchestrating the recruitment of coatomer proteins to the Golgi membrane. The subsequent hydrolysis of ARF1-bound GTP, facilitated by ARFGAPs proteins, becomes essential for the dissociation of coat proteins from Golgi membranes and vesicles. Additionally, the GTP-bound form of ARF1 interacts with PICK1, regulating AMPA receptor (AMPAR) trafficking and influencing synaptic plasticity of excitatory synapses, as well as spine shrinkage during long-term depression (LTD). In the context of microbial infection, ARF1 takes on an unexpected role as an allosteric activator of the cholera toxin catalytic subunit, functioning in ADP-ribosyltransferase activity.

Human

E. coli

N-10*His;C-Myc;N-GST

P84077 (G2-K181)

375  [NCBI]

Full Length of Mature Protein

GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Approximately 55 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.