1. Recombinant Proteins
  2. Others
  3. AQP4 Protein, Human (His)

The AQP4 protein forms water-specific channels and is involved in brain water balance and solute transport. AQP4 Protein, Human (His) is the recombinant human-derived AQP4, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The AQP4 protein forms water-specific channels and is involved in brain water balance and solute transport. AQP4 Protein, Human (His) is the recombinant human-derived AQP4, expressed by E. coli , with N-6*His labeled tag.

Background

AQP4, a water-specific channel, is instrumental in maintaining brain water homeostasis and facilitating glymphatic solute transport. It plays a crucial role in regulating the exchange of water across the blood-brain interface, influencing cerebrospinal fluid influx into the brain cortex and parenchyma through paravascular spaces surrounding penetrating arteries. Additionally, AQP4 is essential for the proper drainage of interstitial fluid along paravenous pathways, contributing to the normal clearance of solutes, including soluble beta-amyloid peptides derived from APP, from the brain interstitial fluid. While redundant in urinary water homeostasis and concentrating ability, AQP4 forms homotetramers, with the tetramers capable of organizing into oligomeric arrays of varying sizes in membranes. This oligomerization can facilitate cell-cell adhesion through interactions between AQP4 arrays in adjacent cells. AQP4 is also part of a complex involving MLC1, TRPV4, HEPACAM, and ATP1B1, highlighting its role within a larger molecular network.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P55087-1 (C253-V323)

Gene ID

361

Protein Length

Partial

Synonyms
AQP 4; AQP-4; AQP4; AQP4_HUMAN; Aquaporin type 4; Aquaporin-4; Aquaporin4; HMIWC 2; HMIWC2; Mercurial insensitive water channel; Mercurial-insensitive water channel; MGC22454; MIWC; WCH 4; WCH4
AA Sequence

CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Molecular Weight

Approximately 16 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 20% Acetonitrile, pH 4.15.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AQP4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AQP4 Protein, Human (His)
Cat. No.:
HY-P72087A
Quantity:
MCE Japan Authorized Agent: