1. Recombinant Proteins
  2. Others
  3. AQP1 Protein, Human (GST)

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (GST) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (GST) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-GST labeled tag.

Background

AQP1, a water-specific channel, plays a pivotal role in enhancing the permeability of plasma membranes in red blood cells and kidney proximal tubules, allowing water movement along osmotic gradients. It forms homotetramers and is a key component of the ankyrin-1 complex, a multiprotein assembly crucial for maintaining the stability and shape of erythrocyte membranes. In the erythrocyte, the ankyrin-1 complex consists of AQP1 along with ANK1, RHCE, RHAG, SLC4A1, EPB42, GYPA, and GYPB. AQP1's functional versatility is further highlighted by its interaction with EPHB2, contributing to endolymph production in the inner ear. Additionally, AQP1 participates in complexes involving STOM. The protein establishes interactions both via its N-terminal region with ANK1 and via its C-terminal region with EPB42, emphasizing its engagement in various cellular processes and protein assemblies.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P29972 (G220-K269)

Gene ID

358  [NCBI]

Molecular Construction
N-term
GST
AQP1 (G220-K269)
Accession # P29972
C-term
Protein Length

Partial

Synonyms
AQP 1; AQP CHIP; AQP-1; AQP1; AQP1_HUMAN; aquaporin 1 channel-forming integral protein; 28kDa; CO blood group; ; aquaporin 1 Colton blood group; ; Aquaporin CHIP; Aquaporin-1; Aquaporin-CHIP; Aquaporin1; Channel forming integral protein 28kDa; Channel like integral membrane protein 28 kDa; CHIP 28; CHIP28; CO;
AA Sequence

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Molecular Weight

Approximately 31 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm solution of Tris-based buffer, 50% Glycerol or 50 mM Tris-HCl, 300 mM NaCL, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AQP1 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AQP1 Protein, Human (GST)
Cat. No.:
HY-P72086
Quantity:
MCE Japan Authorized Agent: