1. Recombinant Proteins
  2. Others
  3. Apolipoprotein E/APOE Protein, Mouse (HEK293, His)

Apolipoprotein E/APOE Protein, Mouse (HEK293, His)

Cat. No.: HY-P7532
Handling Instructions Technical Support

Apolipoprotein E/APOE is a key molecule linking lipid metabolism and neurological function. Apolipoprotein E/APOE gene polymorphisms are closely associated with diseases such as Alzheimer’s disease and atherosclerosis by influencing protein structure and function. Apolipoprotein E/APOE Protein, Mouse (HEK293, His) is a recombinant APOE protein expressed in HEK293 cells, with a C-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Apolipoprotein E/APOE is a key molecule linking lipid metabolism and neurological function. Apolipoprotein E/APOE gene polymorphisms are closely associated with diseases such as Alzheimer’s disease and atherosclerosis by influencing protein structure and function. Apolipoprotein E/APOE Protein, Mouse (HEK293, His) is a recombinant APOE protein expressed in HEK293 cells, with a C-6*His tag[1][2][3].

Background

Apolipoprotein E/APOE is a member of the soluble apolipoprotein family, primarily synthesized in the liver and brain. Liver-derived Apolipoprotein E/APOE participates in peripheral lipid metabolism, while brain-derived Apolipoprotein E/APOE, produced by astrocytes, is involved in neuronal repair and synaptic plasticity. Apolipoprotein E/APOE plays a critical role in lipid transport within both plasma and the central nervous system by interacting with the low-density lipoprotein receptor family. The three common Apolipoprotein E/APOE isoforms (APOE2, APOE3, APOE4), differing in amino acids at positions 112 and 158, have distinct effects on the risk of diseases such as atherosclerosis and Alzheimer’s disease. Due to domain interactions and lower stability, APOE4 is a major genetic risk factor for Alzheimer’s disease, while APOE2 is associated with type III hyperlipoproteinemia due to weak receptor binding[1][2][3].

Biological Activity

Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 this effect is 15-50 ng/mL.

  • Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 for this effect is 41.72 ng/ml, corresponding to a specific activity is 2.39×104 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P08226 (E19-Q311)

Gene ID
Molecular Construction
N-term
APOE (E19-Q311)
Accession # P08226
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuApolipoprotein E, His; ApoE; Apolipoprotein E
AA Sequence

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQHHHHHH

Molecular Weight

Approximately 34-40 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Apolipoprotein E/APOE Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7532
Quantity:
MCE Japan Authorized Agent: