1. Recombinant Proteins
  2. Others
  3. Apolipoprotein E/APOE Protein, Rabbit (His-SUMO)

Apolipoprotein E/APOE Protein, Rabbit (His-SUMO)

Cat. No.: HY-P72083
Handling Instructions Technical Support

Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.

Background

APOE is a protein that plays a crucial role in the transport of lipids between organs through plasma and interstitial fluids. It is a key component of various lipoproteins, including chylomicrons, VLDL, IDL, and HDL. APOE binds to a wide range of cellular receptors, such as LDLR and VLDLR, facilitating the uptake of lipoprotein particles. Additionally, APOE has a heparin-binding activity and interacts with heparan-sulfate proteoglycans on cell surfaces, supporting the capture and uptake of lipoproteins. It forms a homotetramer and can interact with ABCA1 in the formation of HDLs. APOE may also interact with other proteins like APP/A4 amyloid-beta peptide, MAPT, MAP2, secreted SORL1, and PMEL for various physiological processes.

Species

Rabbit

Source

E. coli

Tag

N-10*His;N-SUMO

Accession

P18287 (T20-Q311)

Gene ID
Molecular Construction
N-term
10*His-SUMO
APOE (T20-Q311)
Accession # P18287
C-term
Protein Length

Full Length of Mature Protein

Synonyms
APOEApolipoprotein E; Apo-E
AA Sequence

TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Predicted Molecular Mass
53.6 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Apolipoprotein E/APOE Protein, Rabbit (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein E/APOE Protein, Rabbit (His-SUMO)
Cat. No.:
HY-P72083
Quantity:
MCE Japan Authorized Agent: