1. Recombinant Proteins
  2. Others
  3. APOD Protein, Human (HEK293, C-His)

APOD Proteinas is an anti-inflammatory antagonist in the IL-1 family, targeting IL1B and IL1A to prevent immune dysregulation and systemic inflammation. Its ability to modulate inflammatory responses has important implications for potential therapeutic intervention in inflammatory diseases. APOD Protein, Human (HEK293, C-His) is the recombinant human-derived APOD protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

APOD Proteinas is an anti-inflammatory antagonist in the IL-1 family, targeting IL1B and IL1A to prevent immune dysregulation and systemic inflammation. Its ability to modulate inflammatory responses has important implications for potential therapeutic intervention in inflammatory diseases. APOD Protein, Human (HEK293, C-His) is the recombinant human-derived APOD protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The IL-1RA/IL-1RN Protein operates as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines such as interleukin-1beta/IL1B and interleukin-1alpha/IL1A. This protein serves as a crucial safeguard against immune dysregulation and uncontrolled systemic inflammation triggered by IL1, responding to various innate stimulatory agents, including pathogens. Its ability to modulate the inflammatory response highlights its significance in potential therapeutic interventions aimed at managing inflammatory disorders and maintaining immune balance. Shifting focus to the Alpha 1-Microglobulin Protein, it emerges as a multifunctional antioxidant and tissue repair agent, exhibiting reductase, heme-binding, and radical-scavenging activities. Operating in both intravascular and extravascular spaces, this protein plays a pivotal role in red cell homeostasis, protecting against heme-induced cell damage and mitigating oxidative stress. Its diverse functions span from preventing hemolysis in red blood cells to reducing extracellular methemoglobin and inhibiting oxidation of low-density lipoprotein particles during acute inflammation. Moreover, Alpha 1-Microglobulin safeguards against oxidation products in the extracellular matrix and cell membranes, contributing to cellular and extracellular matrix integrity. Within the intracellular milieu, it maintains mitochondrial redox homeostasis, offering protection against heme-induced oxidative damage and facilitating correct protein folding in the endoplasmic reticulum. Additionally, this protein exhibits antiprotease activity, inhibiting key proteases involved in inflammatory and cytotoxic responses, and plays a crucial role in extracellular matrix remodeling and cell adhesion.

Species

Human

Source

HEK293

Tag

C-His

Accession

P05090 (Q21-S189)

Gene ID

347  [NCBI]

Molecular Construction
N-term
APOD (Q21-S189)
Accession # P05090
10*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuApolipoprotein D, His; ApoD; Apolipoprotein D
AA Sequence

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

Molecular Weight

25-40 kDa

Glycosylation
Yes
Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 o r20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

APOD Protein, Human (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APOD Protein, Human (HEK293, C-His)
Cat. No.:
HY-P7530A
Quantity:
MCE Japan Authorized Agent: