1. Recombinant Proteins
  2. Others
  3. APOC3 Protein, Human (His-SUMO)

APOC3 protein is found in VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates VLDL1 assembly and secretion and assists in lipid transport. APOC3 Protein, Human (His-SUMO) is the recombinant human-derived APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

APOC3 protein is found in VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates VLDL1 assembly and secretion and assists in lipid transport. APOC3 Protein, Human (His-SUMO) is the recombinant human-derived APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

APOC3 protein, a constituent of both triglyceride-rich very low-density lipoproteins (VLDL) and high-density lipoproteins (HDL) in plasma, plays a multifaceted role in triglyceride homeostasis. Intracellularly, it facilitates the assembly and secretion of hepatic very low-density lipoprotein 1 (VLDL1), contributing to lipid transport. Extracellularly, APOC3 serves to modulate the hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). This functionality involves inhibiting lipoprotein lipase and impeding the hepatic uptake of TRLs through remnant receptors. Structurally, APOC3 is characterized by several curved helices connected via semiflexible hinges, allowing it to tightly wrap around the curved micelle surface and adapt to the varying diameters of its natural binding partners. This structural flexibility underscores its versatile involvement in lipid metabolism and transport processes.

Biological Activity

Immobilized Human APOC3 at 2 μg/mL (100 μL/Well) on the plate can bind Anti-APOC3 Antibody. The ED50 for this effect is 41.04 ng/mL.

  • Immobilized Human APOC3 at 2 μg/mL (100 μL/Well) on the plate can bind Anti-APOC3 Antibody. The ED50 for this effect is 41.04 ng/mL.
Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P02656 (S21-A99)

Gene ID

345  [NCBI]

Molecular Construction
N-term
6*His-SUMO
APOC3 (S21-A99)
Accession # P02656
C-term
Protein Length

Full Length of Mature Protein

Synonyms
APOC3; APO C3; Apo CIII; Apo-CIII; APOC 3; ApoC III; ApoC-III; APOC3; APOC3_HUMAN; ApoCIII; Apolipoprotein C III; Apolipoprotein C-III; Apolipoprotein C3; ApolipoproteinCIII; MGC150353
AA Sequence

SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Molecular Weight

Approximately 22-24.8 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

APOC3 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APOC3 Protein, Human (His-SUMO)
Cat. No.:
HY-P72081
Quantity:
MCE Japan Authorized Agent: