1. Recombinant Proteins
  2. Others
  3. APCDD1 Protein, Human (466a.a, HEK293, Fc)

APCDD1 protein, a homodimer, negatively regulates the Wnt signaling pathway, acting cell-autonomously upstream of beta-catenin. Implicated in colorectal tumorigenesis, it interacts with LRP5 and WNT3A, suggesting involvement in complex interactions with Wnt and LRP proteins. APCDD1's pivotal role is evident in its contribution to intricate regulatory mechanisms governing Wnt signaling. APCDD1 Protein, Human (466a.a, HEK293, Fc) is the recombinant human-derived APCDD1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

APCDD1 protein, a homodimer, negatively regulates the Wnt signaling pathway, acting cell-autonomously upstream of beta-catenin. Implicated in colorectal tumorigenesis, it interacts with LRP5 and WNT3A, suggesting involvement in complex interactions with Wnt and LRP proteins. APCDD1's pivotal role is evident in its contribution to intricate regulatory mechanisms governing Wnt signaling. APCDD1 Protein, Human (466a.a, HEK293, Fc) is the recombinant human-derived APCDD1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

APCDD1 protein operates as a negative regulator within the Wnt signaling pathway, exerting its inhibitory influence in a cell-autonomous manner and functioning upstream of beta-catenin. Its potential role in colorectal tumorigenesis suggests its significance in cellular processes associated with this condition. As a homodimer, APCDD1 interacts with LRP5 and WNT3A, indicating its involvement in complex interactions with Wnt and LRP proteins. These interactions collectively contribute to the intricate regulatory mechanisms that govern Wnt signaling, highlighting APCDD1's pivotal role in modulating this pathway.

Biological Activity

Immobilized Human APCDD1, hFc Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Anti-APCDD1 Antibody, hFc Tag with the EC50 of 17.8 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q8J025 (L27-H492)

Gene ID

147495

Molecular Construction
N-term
APCDD1 (L27-H492)
Accession # Q8J025
hFc
C-term
Synonyms
Adenomatosis polyposis coli down-regulated 1 protein; DRAPC1; HYPT1
AA Sequence

LLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYGRAPGRH

Molecular Weight

82-110 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

APCDD1 Protein, Human (466a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APCDD1 Protein, Human (466a.a, HEK293, Fc)
Cat. No.:
HY-P701326
Quantity:
MCE Japan Authorized Agent: