1. Recombinant Proteins
  2. Others
  3. ANP32A Protein, Human (His)

The multifunctional ANP32A protein regulates multiple cellular processes, including tumor suppression, apoptosis, cell cycle progression, and transcription. It promotes apoptosis by activating caspase-9 and supporting apoptotic body formation. ANP32A Protein, Human (His-GST) is the recombinant human-derived ANP32A protein, expressed by E. coli , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The multifunctional ANP32A protein regulates multiple cellular processes, including tumor suppression, apoptosis, cell cycle progression, and transcription. It promotes apoptosis by activating caspase-9 and supporting apoptotic body formation. ANP32A Protein, Human (His-GST) is the recombinant human-derived ANP32A protein, expressed by E. coli , with N-His, N-GST labeled tag.

Background

The ANP32A protein emerges as a multifunctional regulator involved in diverse cellular processes, encompassing tumor suppression, apoptosis, cell cycle progression, and transcription. Functionally versatile, it promotes apoptosis by facilitating the activation of caspase-9 (CASP9) and supporting apoptosome formation. Additionally, ANP32A contributes to the modulation of histone acetylation and transcription as part of the INHAT (inhibitor of histone acetyltransferases) complex. It exerts inhibitory control over EP300/CREBBP and EP300/CREBBP-associated factor by histone masking, preferentially binding to unmodified histone H3 and impeding its acetylation and phosphorylation, leading to cell growth inhibition. Beyond chromatin dynamics, ANP32A participates in various biochemical processes, including the regulation of mRNA nuclear-to-cytoplasmic translocation and stability through its association with ELAVL1 (Hu-antigen R). The protein also plays a role in E4F1-mediated transcriptional repression and inhibits protein phosphatase 2A. Notably, ANP32A is indispensable for influenza A, B, and C viral genome replication, mediating the assembly of viral replicase asymmetric dimers and playing a crucial role in foamy virus mRNA export from the nucleus. This versatile functionality underscores the integral role of ANP32A in orchestrating multiple cellular pathways.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P39687 (E2-K238)

Gene ID
Molecular Construction
N-term
His-GST
ANP32A (E2-K238)
Accession # P39687
C-term
Protein Length

Partial

Synonyms
Acidic leucine-rich nuclear phosphoprotein 32 family member A; pp32; LANP; Mapmodulin; C15orf1; MAPM; PHAP1
AA Sequence

EMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRK

Molecular Weight

Approximately 28 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ANP32A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANP32A Protein, Human (His)
Cat. No.:
HY-P76150
Quantity:
MCE Japan Authorized Agent: