1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Animal-free Recombinant Proteins
  3. TNF Superfamily NK Cell CD Proteins
  4. TNF Superfamily Ligands TRAIL/CD253
  5. TRAIL/CD253
  6. Animal-Free TRAIL/TNFSF10 Protein, Mouse (His)

Animal-Free TRAIL/TNFSF10 Protein, Mouse (His)

Cat. No.: HY-P7089AF
Handling Instructions Technical Support

TRAIL/TNFSF10 protein binds to TNFRSF10A, TNFRSF10B, TNFRSF10C, TNFRSF10D, and possibly TNFRSF11B, inducing apoptosis.It can be modulated by decoy receptors TNFRSF10C, TNFRSF10D, and TNFRSF11B, which do not induce apoptosis.TRAIL/TNFSF10 exists as a homotrimer, interacting with its receptor monomers.This complex molecular interaction governs apoptotic signaling pathways.Animal-Free TRAIL/TNFSF10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTRAIL/TNFSF10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRAIL/TNFSF10 protein binds to TNFRSF10A, TNFRSF10B, TNFRSF10C, TNFRSF10D, and possibly TNFRSF11B, inducing apoptosis.It can be modulated by decoy receptors TNFRSF10C, TNFRSF10D, and TNFRSF11B, which do not induce apoptosis.TRAIL/TNFSF10 exists as a homotrimer, interacting with its receptor monomers.This complex molecular interaction governs apoptotic signaling pathways.Animal-Free TRAIL/TNFSF10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTRAIL/TNFSF10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Background

The TRAIL/TNFSF10 protein, a cytokine, binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly TNFRSF11B/OPG, inducing apoptosis. Its apoptotic activity may be modulated by binding to decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG, which lack the ability to induce apoptosis. TRAIL/TNFSF10 exists as a homotrimer, where one TRAIL/TNFSF10 homotrimer interacts with three TNFRSF10A monomers and another homotrimer interacts with three TNFRSF10B monomers. This multivalent interaction underscores the intricate molecular interactions governing the apoptotic signaling pathways mediated by TRAIL/TNFSF10 and its receptors.

Biological Activity

Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED50 for this effect is <1 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P50592 (P118-N291)

Gene ID
Molecular Construction
N-term
TRAIL (P118-N291)
Accession # P50592
His
C-term
Protein Length

Partial

Synonyms
rMuTRAIL/TNFSF10; TNF-related apoptosis-inducing ligand; Tumor necrosis factor ligand superfamily member 10
AA Sequence

MPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN

Predicted Molecular Mass
21 kDa
Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free TRAIL/TNFSF10 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free TRAIL/TNFSF10 Protein, Mouse (His)
Cat. No.:
HY-P7089AF
Quantity:
MCE Japan Authorized Agent: