1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TNF Superfamily Neurotrophic Factors
  4. TNF Superfamily Ligands
  5. TNF-alpha
  6. Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His)

Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His)

Cat. No.: HY-P7417AF
Handling Instructions Technical Support

TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen.It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance.Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF-alpha/TNFSF2 protein, expressed by E.coli , with C-His, C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen.It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance.Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF-alpha/TNFSF2 protein, expressed by E.coli , with C-His, C-His labeled tag.This product is for cell culture use only.

Background

TNF-alpha/TNFSF2 Protein is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Secreted mainly by macrophages, it can induce cell death in certain tumor cell lines. Additionally, it acts as a potent pyrogen, causing fever through direct action or by stimulating interleukin-1 secretion and is implicated in the induction of cachexia. Under specific conditions, it can stimulate cell proliferation and promote cell differentiation. In adipocytes, it induces insulin resistance by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, while also leading to GKAP42 protein degradation, contributing to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6. Furthermore, it facilitates osteoclastogenesis, thereby mediating bone resorption. Finally, the TNF intracellular domain (ICD) form of TNF-alpha/TNFSF2 Protein stimulates IL12 production in dendritic cells.

Biological Activity

Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED50 for this effect is <40 pg/mL. The specific activity of recombinant mouse TNF alpha is approximately >2.5x 107 IU/mg

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

P06804 (L80-L235)

Gene ID
Molecular Construction
N-term
TGF-α (L80-L235)
Accession # P06804
6*His
C-term
Protein Length

Full Length of TNF soluble form

Synonyms
rMuTNF-α/TNFSF2; TNF-alpha; Cachectin; DIF; TNFA; Differentiation-inducing factor
AA Sequence

MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Predicted Molecular Mass
18.2 kDa
Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His)
Cat. No.:
HY-P7417AF
Quantity:
MCE Japan Authorized Agent: