1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β TGF-β
  5. TGF-β1
  6. Animal-Free TGF beta 1/TGFB1 Protein, Human (His)

Animal-Free TGF beta 1/TGFB1 Protein, Human (His)

Cat. No.: HY-P700150AF
Handling Instructions Technical Support

TGF beta 1/TGFB1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. TGF beta 1 is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, apoptosis, and can regulate the expression and activation of other growth factors, including interferon gamma and tumor necrosis factor alpha. Animal-Free TGF beta 1/TGFB1 Protein, Human (His) is the recombinant human-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TGF beta 1/TGFB1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. TGF beta 1 is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, apoptosis, and can regulate the expression and activation of other growth factors, including interferon gamma and tumor necrosis factor alpha. Animal-Free TGF beta 1/TGFB1 Protein, Human (His) is the recombinant human-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

Transforming growth factor (TGF) beta 1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. TGF beta 1 is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, apoptosis, and can regulate the expression and activation of other growth factors, including interferon gamma and tumor necrosis factor alpha. In humans, TGF-β1 is encoded by the TGFB1 gene. TGF beta 1 activates CREB3L1 by regulating intramembranous proteolysis, stimulating sustained collagen production. TGF beta 1 mediates SMAD2/3 activation by inducing SMAD2/3 phosphorylation and subsequent translocation to the nucleus and regulates dental papilla cells by promoting IPO7-mediated translocation of phosphorylated SMAD2 to the nucleus and subsequent transcription of target genes. TGF beta 1 induces epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types.TGF beta 1 plays an important role in controlling the immune system, and shows different activities on different types of cell, or cells at different developmental stages[1][2][3][4][5][6].

Biological Activity

1.Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells. The ED50 for this effect is <0.1 ng/mL. The specific activity of recombinant human TGF beta 1 is approximately >5 x 107 IU/mg.
2.Measure by its ability to induce proliferation in MCF-7 cells The ED50 for this effect is <3.2 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

P01137 (A279-S390)

Gene ID
Molecular Construction
N-term
TGFB1 (A279-S390)
Accession # P01137
His
C-term
Protein Length

Full Length of Mature TGFB1

Synonyms
Transforming Growth Factor beta-1; TGF-beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB; TGF-β1; TGF beta1; TGFbeta 1; TGF-beta 1; TGFbeta; TGF-beta-1
AA Sequence

MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Weight

Approximately 13.7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0 or 20 mM sodium citrate and 0.2 M NaCl, pH 4.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 10 mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Animal-Free TGF beta 1/TGFB1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free TGF beta 1/TGFB1 Protein, Human (His)
Cat. No.:
HY-P700150AF
Quantity:
MCE Japan Authorized Agent: