1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. EGF Superfamily
  4. TGF-alpha
  5. Animal-Free TGF alpha/TGFA Protein, Human (His)

Animal-Free TGF alpha/TGFA Protein, Human (His)

Cat. No.: HY-P700149AF
Handling Instructions Technical Support

TGF α/TGFA protein is a mitogenic polypeptide that binds to EGFR and acts synergistically with TGF β to promote anchorage-dependent cell proliferation. Its interaction with MAGI3, SDCBP, and the SNTA1 PDZ domain, especially with SDCBP, is critical for efficient cell surface targeting. Animal-Free TGF alpha/TGFA Protein, Human (His) is the recombinant human-derived animal-FreeTGF alpha/TGFA protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TGF α/TGFA protein is a mitogenic polypeptide that binds to EGFR and acts synergistically with TGF β to promote anchorage-dependent cell proliferation. Its interaction with MAGI3, SDCBP, and the SNTA1 PDZ domain, especially with SDCBP, is critical for efficient cell surface targeting. Animal-Free TGF alpha/TGFA Protein, Human (His) is the recombinant human-derived animal-FreeTGF alpha/TGFA protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The TGF alpha/TGFA protein, a mitogenic polypeptide, demonstrates the capacity to bind to the EGF receptor/EGFR and synergistically acts with TGF beta, facilitating anchorage-independent cell proliferation in soft agar. This protein interacts with the PDZ domains of MAGI3, SDCBP, and SNTA1, with the association with SDCBP being crucial for effective targeting to the cell surface. In its immature form within the endoplasmic reticulum, characterized by a prosegment and lacking full N-glycosylation, TGF alpha/TGFA interacts with CNIH. Furthermore, in the Golgi apparatus, it may form a complex with CNIH and GORASP2. Additionally, through its cytoplasmic C-terminal domain, TGF alpha/TGFA interacts with NKD2, thereby exhibiting a spectrum of potential functional roles in diverse cellular compartments and interactions.

Biological Activity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human TGF alpha is > 5 x 106 IU/mg.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P01135 (V40-A89)

Gene ID
Molecular Construction
N-term
TGF-α (V40-A89)
Accession # P01135
6*His
C-term
Protein Length

Full Length of TGFA

Synonyms
ETGF; TGF-alpha; TGF type 1; TGFA
AA Sequence

MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Predicted Molecular Mass
6.5 kDa
Molecular Weight

Approximately 7 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose or 20 mM sodium citrate and 0.2 M NaCl, pH 4.5.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free TGF alpha/TGFA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free TGF alpha/TGFA Protein, Human (His)
Cat. No.:
HY-P700149AF
Quantity:
MCE Japan Authorized Agent: