1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Neurotrophic Factors
  4. Leukemia Inhibitory Factor
  5. Animal-Free LIF Protein, Mouse (His)

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation.It also stimulates acute-phase protein synthesis in hepatocytes.LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses.Animal-Free LIF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeLIF protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation.It also stimulates acute-phase protein synthesis in hepatocytes.LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses.Animal-Free LIF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeLIF protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Background

LIF (Leukemia Inhibitory Factor) exhibits the capability to prompt terminal differentiation in leukemic cells, showcasing a diverse range of activities. Notably, it induces hematopoietic differentiation in both normal and myeloid leukemia cells, facilitates neuronal cell differentiation, and stimulates the synthesis of acute-phase proteins in hepatocytes. This multifaceted role underscores LIF's significance in orchestrating various cellular processes, contributing to the regulation of hematopoiesis, neurogenesis, and hepatic responses.

Biological Activity

Measure by its ability to induce IL-6 secretion in M1 cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse LIF is >2 x 106 IU/mg.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P09056 (S24-F203)

Gene ID
Molecular Construction
N-term
6*His
LIF (S24-F203)
Accession # P09056
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Leukemia inhibitory factor; HILDA; D factor; MLPLI
AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Predicted Molecular Mass
20.7 kDa
Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free LIF Protein, Mouse (His)
Cat. No.:
HY-P700220AF
Quantity:
MCE Japan Authorized Agent: