1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. IP-10/CXCL10
  6. Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His)

Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His)

Cat. No.: HY-P700168AF
Handling Instructions Technical Support

The IP-10/CRG-2/CXCL10 protein is a proinflammatory cytokine that regulates immune cells, cell growth, apoptosis, and vasostatic effects. It is critical during viral infection by binding to CXCR3 to activate immune cells and migrate them to the site of infection. Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IP-10/CRG-2/CXCL10 protein is a proinflammatory cytokine that regulates immune cells, cell growth, apoptosis, and vasostatic effects. It is critical during viral infection by binding to CXCR3 to activate immune cells and migrate them to the site of infection. Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

The IP-10/CRG-2/CXCL10 Protein is a pro-inflammatory cytokine that is involved in various processes such as chemotaxis, differentiation, and activation of immune cells, as well as the regulation of cell growth, apoptosis, and modulation of angiostatic effects. It plays a crucial role during viral infections by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, it binds to the CXCR3 receptor, which activates G protein-mediated signaling and leads to the activation of the phospholipase C-dependent pathway, increased intracellular calcium production, and actin reorganization. This activation of the CXCL10/CXCR3 axis is also important in neurons in response to brain injury, as it activates microglia and directs them to the site of injury, facilitating neuronal reorganization. The IP-10/CRG-2/CXCL10 Protein can exist as a monomer, dimer, or tetramer and interacts with the CXCR3 receptor.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <0.2 μg/mL

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P17515 (I22-P98)

Gene ID
Molecular Construction
N-term
His
CXCL10 (I22-P98)
Accession # P17515
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IP-10; Gamma-Interferon Inducible Protein 10; Crg-2
AA Sequence

IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Molecular Weight

Approximately 9.47 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His)
Cat. No.:
HY-P700168AF
Quantity:
MCE Japan Authorized Agent: