1. Recombinant Proteins
  2. Animal-free Recombinant Proteins
  3. Animal-Free Intrinsic Factor/GIF Protein, Human (His)

Animal-Free Intrinsic Factor/GIF Protein, Human (His)

Cat. No.: HY-P700085AF
Handling Instructions Technical Support

Intrinsic factor (GIF) plays a crucial role in cobalamin (Cbl) absorption in the ileum. This well-coordinated process involves the interaction of the CBLIF-cobalamin complex with the Cubilin (CUBN) receptor, leading to internalization via receptor-mediated endocytosis. Animal-Free Intrinsic Factor/GIF Protein, Human (His) is the recombinant human-derived animal-FreeIntrinsic Factor/GIF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Intrinsic factor (GIF) plays a crucial role in cobalamin (Cbl) absorption in the ileum. This well-coordinated process involves the interaction of the CBLIF-cobalamin complex with the Cubilin (CUBN) receptor, leading to internalization via receptor-mediated endocytosis. Animal-Free Intrinsic Factor/GIF Protein, Human (His) is the recombinant human-derived animal-FreeIntrinsic Factor/GIF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

Intrinsic Factor (GIF) stands as a key facilitator in the absorption of the essential vitamin cobalamin (Cbl) in the ileum. Its pivotal role unfolds through a well-orchestrated process, where the CBLIF-cobalamin complex, upon interaction with the Cubilin (CUBN) receptor, undergoes internalization via receptor-mediated endocytosis. This intricate interplay underscores the significance of GIF in ensuring the effective absorption of cobalamin, a crucial vitamin for various physiological processes. GIF's interaction with CUBN, particularly involving CUB domains, highlights the molecular intricacies governing this essential aspect of vitamin uptake.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P27352-1 (M1-Y417)

Gene ID
Molecular Construction
N-term
GIF (M1-Y417)
Accession # P27352-1
6*His
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Gastric intrinsic factor; GIF; IF; Intrinsic factor; IFMH; INF; TCN3
AA Sequence

MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKV

Molecular Weight

Approximately 46.23 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free Intrinsic Factor/GIF Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free Intrinsic Factor/GIF Protein, Human (His)
Cat. No.:
HY-P700085AF
Quantity:
MCE Japan Authorized Agent: