1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. IL-8/CXCL8
  6. Animal-Free IL-8/CXCL8 Protein, Pig (His)

Animal-Free IL-8/CXCL8 Protein, Pig (His)

Cat. No.: HY-P700250AF
Handling Instructions Technical Support

IL-8/CXCL8 protein, a vital chemotactic factor, orchestrates inflammatory responses by attracting neutrophils, basophils, and T-cells to clear pathogens. It activates neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. IL-8/CXCL8 homodimerizes, disrupted by tick evasin-3, and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. Animal-Free IL-8/CXCL8 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-8/CXCL8 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-8/CXCL8 protein, a vital chemotactic factor, orchestrates inflammatory responses by attracting neutrophils, basophils, and T-cells to clear pathogens. It activates neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. IL-8/CXCL8 homodimerizes, disrupted by tick evasin-3, and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. Animal-Free IL-8/CXCL8 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-8/CXCL8 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-8/CXCL8 protein serves as a pivotal chemotactic factor, playing a central role in mediating inflammatory responses by attracting neutrophils, basophils, and T-cells to effectively clear pathogens and protect the host from infections. It also contributes significantly to neutrophil activation. Released in response to inflammatory stimuli, IL-8/CXCL8 exerts its effects by binding to G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes, and endothelial cells. The G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptors, and activation by IL-8 leads to the release of beta and gamma subunits from Galpha (GNAI2 in neutrophils) and subsequent activation of downstream signaling pathways, including PI3K and MAPK pathways. IL-8/CXCL8 forms homodimers, and this dimerization is disrupted by tick evasin-3. Furthermore, IL-8/CXCL8 interacts with TNFAIP6 via its Link domain, and this interaction interferes with chemokine binding to glycosaminoglycans, suggesting a regulatory role in modulating chemokine activity within the inflammatory microenvironment.

Species

Pig

Source

E. coli

Tag

C-6*His

Accession

CAA43461 (A26-Q103)

Gene ID
Molecular Construction
N-term
IL-8 (A26-Q103)
Accession # CAA43461
6*His
C-term
Protein Length

Partial

Synonyms
Interleukin-8; IL-8; C-X-C Motif Chemokine 8; CXCL8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived NeutrophIL Chemotactic Factor; MDNCF; Monocyte-Derived NeutrophIL-Activating Peptide; MONAP; NeutrophIL-Activating Protein 1; NAP-1
AA Sequence

MARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ

Predicted Molecular Mass
10 kDa
Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Documentation

Animal-Free IL-8/CXCL8 Protein, Pig (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-8/CXCL8 Protein, Pig (His)
Cat. No.:
HY-P700250AF
Quantity:
MCE Japan Authorized Agent: