1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-4
  5. Animal-Free IL-4 Protein, Human (His)

The IL-4 protein is primarily secreted by mast cells, T cells, eosinophils, and basophils and is critical for antibody production, hematopoiesis, and immune responses. It induces MHC class II expression on B cells, enhances IgE and IgG1 secretion, and modulates CD23 and IL31RA expression. Animal-Free IL-4 Protein, Human (His) is the recombinant human-derived animal-FreeIL-4 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free IL-4 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-4 protein is primarily secreted by mast cells, T cells, eosinophils, and basophils and is critical for antibody production, hematopoiesis, and immune responses. It induces MHC class II expression on B cells, enhances IgE and IgG1 secretion, and modulates CD23 and IL31RA expression. Animal-Free IL-4 Protein, Human (His) is the recombinant human-derived animal-FreeIL-4 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

The cytokine IL-4, primarily secreted by mast cells, T-cells, eosinophils, and basophils, plays a crucial role in regulating antibody production, hematopoiesis, inflammation, and the development of effector T-cell responses. IL-4 induces the expression of class II MHC molecules on resting B-cells and enhances both the secretion and cell surface expression of IgE and IgG1, contributing to immune responses. Additionally, IL-4 regulates the expression of the low-affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes and positively regulates IL31RA expression in macrophages. Furthermore, IL-4 stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4. Beyond its immunological functions, IL-4 plays a critical role in higher functions of the normal brain, such as memory and learning. Upon binding to its receptor, IL-4R, IL-4 initiates signaling through two types of receptor complexes, type 1 mainly on hematopoietic cells and type 2 on nonhematopoietic cells, activating JAK3 and to a lesser extent JAK1 phosphorylation, leading to the activation of the signal transducer and activator of transcription 6/STAT6. IL-4 interacts with both IL-4R and IL13RA1 to mediate its diverse physiological effects.

Biological Activity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human IL-4 is approximately >2.8 x 107 IU/mg

Species

Human

Source

E. coli

Tag

C-His

Accession

P05112-1 (H25-S153)

Gene ID
Molecular Construction
N-term
IL-4 (H25-S153)
Accession # P05112-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Interleukin-4; IL-4; B-Cell Stimulatory Factor 1; BSF-1; Binetrakin; Lymphocyte Stimulatory Factor 1; Pitrakinra; IL4
AA Sequence

MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Predicted Molecular Mass
15.9 kDa
Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-4 Protein, Human (His)
Cat. No.:
HY-P700130AF
Quantity:
MCE Japan Authorized Agent: