1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-36RA
  5. Animal-Free IL-36RN Protein, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The IL-36RN Protein acts as an inhibitor by binding to the interleukin-36 (IL36A, IL36B, and IL36G) receptor IL1RL2/IL-36R, preventing its association with the coreceptor IL1RAP and inhibiting downstream signaling. This protein is a crucial component of the IL-36 signaling system, which is implicated in local inflammatory responses, particularly in epithelial barriers. Proposed to play a role in skin inflammation and contribute to the innate immune response against fungal pathogens, the IL-36RN Protein may activate an anti-inflammatory signaling pathway by recruiting SIGIRR. Notably, it interacts with the cargo receptor TMED10, facilitating translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion.

Biological Activity

Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED50 for this effect is <2 µg/mL

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

Q9QYY1 (M2-D156)

Gene ID
Molecular Construction
N-term
IL-36RN (M2-D156)
Accession # Q9QYY1
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL-36RA; IL-36RA; Interleukin-36 Receptor Antagonist Protein; IL-1RP3; Interleukin-1; Interleukin-1 FamILy Member 5; IL-1F5; Interleukin-1-Like Protein 1; IL-1L1; IL36RN; FIL1D; IL1F5; IL1HY1; IL1RP3
AA Sequence

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Predicted Molecular Mass
17.8 kDa
Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free IL-36RN Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-36RN Protein, Mouse (His)
Cat. No.:
HY-P700212AF
Quantity:
MCE Japan Authorized Agent: