1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-33
  5. Animal-Free IL-33 Protein, Human (His)

IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. Animal-Free IL-33 Protein, Human (His) is the recombinant human-derived animal-FreeIL-33 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free IL-33 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. Animal-Free IL-33 Protein, Human (His) is the recombinant human-derived animal-FreeIL-33 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

IL-33 protein, functioning as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. Its involvement in the maturation of Th2 cells contributes to the secretion of T-helper type 2-associated cytokines. Additionally, IL-33 plays a crucial role in the activation of mast cells, basophils, eosinophils, and natural killer cells. Acting as an enhancer of the polarization of alternatively activated macrophages, it serves as a chemoattractant for Th2 cells and may function as an 'alarmin,' amplifying immune responses during tissue injury. IL-33 induces rapid UCP2-dependent mitochondrial rewiring, mitigating the generation of reactive oxygen species and preserving the integrity of the Krebs cycle, which is essential for the persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelia, the uncleaved form of IL-33 is constitutively and abundantly expressed, acting as a chromatin-associated nuclear factor with transcriptional repressor properties, potentially sequestering nuclear NF-kappaB/RELA and thereby lowering the expression of its targets; this form is rapidly lost upon angiogenic or pro-inflammatory activation.

Biological Activity

1.Measure by its ability to bind with recombinant ST2L (IL-33 receptor). The ED50 for this effect is <54 ng/mL.
2.Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50for this effect is <0.1 ng/mL. The specific activity of recombinant human IL-33 is approximately >4 x107 IU/ mg

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O95760-1 (S112-T270)

Gene ID
Molecular Construction
N-term
IL-33 (S112-T270)
Accession # O95760-1
6*His
C-term
Protein Length

Partial

Synonyms
Interleukin-33; IL-33; Interleukin-1 Family Member 11; IL-1F11; Nuclear Factor From High Endothelial Venules; NF-HEV; IL33; C9orf26; IL1F11; NFHEV
AA Sequence

MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Predicted Molecular Mass
19 kDa
Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-33 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-33 Protein, Human (His)
Cat. No.:
HY-P70475AF
Quantity:
MCE Japan Authorized Agent: