1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-27
  5. Animal-Free IL-30/IL-27A Protein, Mouse (His)

Animal-Free IL-30/IL-27A Protein, Mouse (His)

Cat. No.: HY-P700206AF
Handling Instructions Technical Support

The IL-30/IL-27A protein is a component of the Ragulator complex, which is critical for amino acids and activates mTORC1 to regulate cell growth in response to different signals. The lysosomal V-ATPase and Ragulator complex act as GEFs for Rag GTPase, promoting amino acid activation. Animal-Free IL-30/IL-27A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-30/IL-27A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
2 μg Ask For Quote & Lead Time
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-30/IL-27A protein is a component of the Ragulator complex, which is critical for amino acids and activates mTORC1 to regulate cell growth in response to different signals. The lysosomal V-ATPase and Ragulator complex act as GEFs for Rag GTPase, promoting amino acid activation. Animal-Free IL-30/IL-27A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-30/IL-27A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

LAMTOR2, as an integral component of the Ragulator complex, plays a crucial role in amino acid sensing and the activation of mTORC1, a signaling complex pivotal for cell growth regulation in response to various cues such as growth factors, energy levels, and amino acids. Amino acid activation is facilitated by the lysosomal V-ATPase, and the Ragulator complex, acting as both a guanine nucleotide exchange factor (GEF) for small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD) and a mediator for their recruitment to the lysosome membrane. The activated Ragulator and Rag GTPases then serve as a scaffold, recruiting mTORC1 to lysosomes for subsequent activation. LAMTOR2 is part of the Ragulator complex, which also includes LAMTOR1, LAMTOR3, LAMTOR4, and LAMTOR5. The complex interacts with mTORC1, Rag GTPases, and the lysosomal amino acid sensor SLC38A9. Additionally, LAMTOR2 participates in the lysosomal folliculin complex (LFC), contributing to cellular signaling pathways involved in growth and nutrient sensing.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q8K3I6 (F29-S234)

Gene ID
Molecular Construction
N-term
IL-30 (F29-S234)
Accession # Q8K3I6
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL-27 p28 subunit; IL-27 subunit alpha; IL27; IL-27; IL27A; IL-27-A; IL27-A; IL27p28; IL30; interleukin 27; interleukin 30; interleukin-27 subunit alpha; MGC71873; p28IL-27A
AA Sequence

MFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Weight

Approximately 24.51 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Documentation

Animal-Free IL-30/IL-27A Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-30/IL-27A Protein, Mouse (His)
Cat. No.:
HY-P700206AF
Quantity:
MCE Japan Authorized Agent: