1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. CSF & Receptors
  4. Multi-CSF/IL-3
  5. Animal-Free IL-3 Protein, Human (His)

Animal-Free IL-3 Protein, Human (His) is the recombinant human-derived animal-FreeIL-3 protein, expressed by E. coli, with C-His labeled tag., has molecular weight of ~16 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Animal-Free IL-3 Protein, Human (His) is the recombinant human-derived animal-FreeIL-3 protein, expressed by E. coli, with C-His labeled tag., has molecular weight of ~16 kDa.This product is for cell culture use only.

Background

IL-3 Protein is a cytokine primarily secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, and it plays a vital role in regulating hematopoietic progenitor cell production and differentiation into specific cell lineages. Additionally, IL-3 stimulates the functional activation of mature basophils, eosinophils, and monocytes. It also has important functions in neural cell proliferation and survival, and it participates in maintaining bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. The biological effects of IL-3 are mediated through a receptor complex composed of the IL3RA subunit and the IL3RB signal transducing subunit, which leads to the rapid activation of JAK2 kinase activity and subsequent STAT5-mediated transcriptional programming. Furthermore, in non-hematopoietic systems, IL-3 contributes to cell survival during oxidative stress by activating pathways involving PI3K/AKT and ERK.

Biological Activity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.15 ng/mL. The specific activity of recombinant human IL-3 is approximately >1.2 x 106 IU/mg

Species

Human

Source

E. coli

Tag

C-6*His

Accession

AAC08706.1 (A20-F152)

Gene ID

3562

Molecular Construction
N-term
IL-3 (A20-F152)
Accession # ATV93543.1
6*His
C-term
Protein Length

Partial

Synonyms
rHuIL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor
AA Sequence

MAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Predicted Molecular Mass
16 kDa
Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-3 Protein, Human (His)
Cat. No.:
HY-P70576AF
Quantity:
MCE Japan Authorized Agent: