1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-27
  5. IL-27 beta/EBI3
  6. Animal-Free IL-27 beta/EBI3 Protein, Human (His)

Animal-Free IL-27 beta/EBI3 Protein, Human (His)

Cat. No.: HY-P700118AF
Handling Instructions Technical Support

The IL-27 beta/EBI3 protein binds to IL27 to form IL-27 interleukin, which is critical in innate immunity. IL-27 has both pro- and anti-inflammatory properties, regulating T helper cell development, inhibiting T cell proliferation, stimulating cytotoxic T cell activity, inducing B cell isotype switching, and affecting innate immune cells. Animal-Free IL-27 beta/EBI3 Protein, Human (His) is the recombinant human-derived animal-FreeIL-27 beta/EBI3 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-27 beta/EBI3 protein binds to IL27 to form IL-27 interleukin, which is critical in innate immunity. IL-27 has both pro- and anti-inflammatory properties, regulating T helper cell development, inhibiting T cell proliferation, stimulating cytotoxic T cell activity, inducing B cell isotype switching, and affecting innate immune cells. Animal-Free IL-27 beta/EBI3 Protein, Human (His) is the recombinant human-derived animal-FreeIL-27 beta/EBI3 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The IL-27 beta/EBI3 Protein associates with IL27 to constitute the IL-27 interleukin, a heterodimeric cytokine that plays a crucial role in innate immunity. Demonstrating both pro- and anti-inflammatory properties, IL-27 regulates T-helper cell development, inhibits T-cell proliferation, stimulates cytotoxic T-cell activity, induces isotype switching in B-cells, and exerts diverse effects on innate immune cells. CD4 T-helper cells, under IL-27 influence, can differentiate into type 1 effector cells (TH1), type 2 effector cells (TH2), and IL-17-producing helper T-cells (TH17). IL-27 facilitates the rapid clonal expansion of naive CD4 T-cells, but not memory CD4 T-cells, and synergizes strongly with IL-12 to induce interferon-gamma/IFN-gamma production by naive CD4 T-cells. Binding to the cytokine receptor WSX-1/TCCR, IL-27 contributes to the antitumor and antiangiogenic activities, leading to the activation of production of antiangiogenic chemokines. It forms heterodimers with IL27/IL27A, recognized as interleukin IL-27, and with IL12A, forming interleukin IL-35, both not disulfide-linked. Additionally, IL-27 interacts with SQSTM1.

Biological Activity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <2 ng/mL.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q14213 (R21-K229)

Gene ID
Molecular Construction
N-term
IL-27B (R21-K229)
Accession # Q14213
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-27 subunit alpha; IL-27-A; Interleukin-27 subunit beta; IL-27B; Epstein-Barr virus-in_x0002_duced gene 3 protein; EBV-induced gene 3 protein; EBI3; p28; Interleukin-30; IL-30
AA Sequence

MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Predicted Molecular Mass
24.3 kDa
Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free IL-27 beta/EBI3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-27 beta/EBI3 Protein, Human (His)
Cat. No.:
HY-P700118AF
Quantity:
MCE Japan Authorized Agent: